4M91: HN33/Tusc3-peptide 1

crystal structure of hN33/Tusc3-peptide 1. Determined by X-ray diffraction at 1.1 Å resolution. Released 26 Mar 2014.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,587
Mol. weight: 20.62 kDa
Released: 26 Mar 2014

Explore 4M91 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4M91 contains 10 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-21	19
β-strand	25-26	2	1
α-helix	29-32	4
α-helix	33-37	5
α-helix	40	1
β-strand	44-50	7	1
α-helix	54-56	3
α-helix	59-77	19
β-strand	85-91	7	1
α-helix	96-101	6
β-strand	109-113	5	1
α-helix	121-123	3
β-strand	124	1	1
α-helix	127-130	4
α-helix	134-145	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor suppressor candidate 3	A	protein	161	Homo sapiens	Q13454 (AlphaFold model)
Protein cereblon	B	protein	12	Homo sapiens	Q96SW2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4M91_1 Tumor suppressor candidate 3 (chains A)
ASKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSV
SRQANEEYQILANSWRYSSAFSNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPK
RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRLEHHHHHH

Sequence of entity 2 (B), FASTA

>4M91_2 Protein cereblon (chains B)
KRKFHCANLTSW

Primary citation

Structural basis of substrate specificity of human oligosaccharyl transferase subunit n33/tusc3 and its role in regulating protein N-glycosylation. Mohorko, E., Owen, R.L., Malojcic, G. et al. Structure (2014) 22:590-601. DOI 10.1016/j.str.2014.02.013 · PubMed

Other PDB entries of the same protein (UniProt Q13454 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M90 1.6 Å, crystal structure of oxidized hN33/Tusc3
4M92 1.6 Å, Crystal structure of hN33/Tusc3-peptide 2
4M8G 2.0 Å, Crystal structure of Se-Met hN33/Tusc3

Browse structure collections

About this viewer

MolViewer shows 4M91 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.