4MBE: Sac3:Sus1:Cdc31:Nup1 complex
Sac3:Sus1:Cdc31:Nup1 complex. Determined by X-ray diffraction at 2.61 Å resolution. Released 2 Jul 2014.
- Method
- X-ray diffraction
- Resolution
- 2.61 Å
- Organism
- Saccharomyces cerevisiae
- Chains
- 10
- Atoms
- 5,085
- Mol. weight
- 84.72 kDa
- Ligands
- CA
- Released
- 2 Jul 2014
Explore 4MBE in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4MBE contains 28 α-helices and 10 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 8 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 19-32 | 14 | |
| β-strand | 39-40 | 2 | 1 |
| α-helix | 42-50 | 9 | |
| α-helix | 58-68 | 11 | |
| β-strand | 76-77 | 2 | 1 |
| α-helix | 78-90 | 13 | |
| α-helix | 94-105 | 12 | |
| β-strand | 112-113 | 2 | 2 |
| α-helix | 115-124 | 10 | |
| α-helix | 131-139 | 9 | |
| β-strand | 149-150 | 2 | 2 |
| α-helix | 151-159 | 9 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 757-804 | 48 | |
Chain C: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-18 | 14 | |
| α-helix | 21-35 | 15 | |
| α-helix | 38-50 | 13 | |
| α-helix | 62-71 | 10 | |
| α-helix | 75-90 | 16 | |
| β-strand | 93 | 1 | 3 |
Chain D: 8 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 19-32 | 14 | |
| β-strand | 39-40 | 2 | 4 |
| α-helix | 42-50 | 9 | |
| α-helix | 58-68 | 11 | |
| β-strand | 76-77 | 2 | 4 |
| α-helix | 78-90 | 13 | |
| α-helix | 94-105 | 12 | |
| β-strand | 112-113 | 2 | 5 |
| α-helix | 115-124 | 10 | |
| α-helix | 131-139 | 9 | |
| β-strand | 149-150 | 2 | 5 |
| α-helix | 151-158 | 8 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 756-804 | 49 | |
Chain F: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-18 | 10 | |
| α-helix | 21-35 | 15 | |
| α-helix | 38-50 | 13 | |
| α-helix | 58-71 | 14 | |
| α-helix | 75-89 | 15 | |
Chain X: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 329 | 1 | 3 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cell division control protein 31 | A, D | protein | 161 | Saccharomyces cerevisiae | P06704 (AlphaFold model) |
| Nuclear mRNA export protein SAC3 | B, E | protein | 53 | Saccharomyces cerevisiae | P46674 (AlphaFold model) |
| Protein SUS1 | C, F | protein | 96 | Saccharomyces cerevisiae | Q6WNK7 (AlphaFold model) |
| Nucleoporin NUP1 | G, H, X, Y | protein | 25 | Saccharomyces cerevisiae | P20676 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>4MBE_1 Cell division control protein 31 (chains A, D)
MSKNRSSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKRE
ILDLIDEYDSEGRHLMKYDDFYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRR
VAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS
Sequence of entity 2 (B, E), FASTA
>4MBE_2 Nuclear mRNA export protein SAC3 (chains B, E)
EANYRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFEKWQAS
Sequence of entity 3 (C, F), FASTA
>4MBE_3 Protein SUS1 (chains C, F)
MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQ
ILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Sequence of entity 4 (G, H, X, Y), FASTA
>4MBE_4 Nucleoporin NUP1 (chains G, H, X, Y)
LKKNIEPKKDKESIVLPTVGFDFIK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CA | Calcium ion | Ca | 4 |
Primary citation
Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export. Jani, D., Valkov, E., Stewart, M. Nucleic Acids Res (2014) 42:6686-6697. DOI 10.1093/nar/gku252 · PubMed
Other PDB entries of the same protein (UniProt P06704 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3FWB 2.5 Å, Sac3:Sus1:Cdc31 complex
- 3FWC 2.7 Å, Sac3:Sus1:Cdc31 complex
- 2DOQ 3.0 Å, crystal structure of Sfi1p/Cdc31p complex
- 2GV5 3.0 Å, crystal structure of Sfi1p/Cdc31p complex
Browse structure collections
About this viewer
MolViewer shows 4MBE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.