Structure of the core fragment of human PR70. Determined by X-ray diffraction at 1.99 Å resolution. Released 13 Aug 2014.
Explore 4MEW in 3D Show helices and sheets RCSB PDB PDBe
4MEW contains 31 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 135-138 | 4 | |
| α-helix | 141-152 | 12 | |
| α-helix | 156-158 | 3 | |
| β-strand | 159-160 | 2 | 1 |
| α-helix | 162-164 | 3 | |
| α-helix | 165-171 | 7 | |
| α-helix | 176-178 | 3 | |
| α-helix | 179-185 | 7 | |
| α-helix | 188-191 | 4 | |
| β-strand | 194-195 | 2 | 1 |
| α-helix | 196-209 | 14 | |
| α-helix | 213-221 | 9 | |
| α-helix | 223 | 1 | |
| β-strand | 229 | 1 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-244 | 10 | |
| α-helix | 246-248 | 3 | |
| α-helix | 249-252 | 4 | |
| α-helix | 255-257 | 3 | |
| α-helix | 258-273 | 16 | |
| β-strand | 281 | 1 | 2 |
| α-helix | 283-287 | 5 | |
| α-helix | 291-297 | 7 | |
| α-helix | 304-306 | 3 | |
| α-helix | 313-326 | 14 | |
| β-strand | 333-334 | 2 | 3 |
| α-helix | 336-341 | 6 | |
| β-strand | 347 | 1 | 4 |
| α-helix | 349-355 | 7 | |
| β-strand | 372-373 | 2 | 3 |
| α-helix | 374-385 | 12 | |
| α-helix | 390-400 | 11 | |
| β-strand | 407-409 | 3 | 5 |
| α-helix | 410-425 | 16 | |
| α-helix | 431-433 | 3 | |
| α-helix | 434-445 | 12 | |
| β-strand | 452-454 | 3 | 5 |
| α-helix | 455-461 | 7 | |
| α-helix | 464-472 | 9 | |
| β-strand | 473 | 1 | 4 |
| α-helix | 477-479 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta | A | protein | 356 | Homo sapiens | Q9Y5P8 (AlphaFold model) |
>4MEW_1 Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta (chains A) SMFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGLVAKACGCPLYWKGPLFYGAG GERTGSVSVHKFVAMWRKILQNCHDDAAKFVHLLMSPGCNYLVQEDFVPFLQDVVNTHPG LSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEEEADINQL TEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGAVTRGRKVQ KEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSM AIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (GOL) are not listed.
Structural and Biochemical Characterization of Human PR70 in Isolation and in Complex with the Scaffolding Subunit of Protein Phosphatase 2A. Dovega, R., Tsutakawa, S., Quistgaard, E.M. et al. PLoS One (2014) 9:e101846-e101846. DOI 10.1371/journal.pone.0101846 · PubMed
Other PDB entries of the same protein (UniProt Q9Y5P8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4MEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.