4MMB: LeuBAT

Crystal structure of LeuBAT (delta6 mutant) in complex with sertraline. Determined by X-ray diffraction at 2.25 Å resolution. Released 16 Oct 2013.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Aquifex aeolicus
Chains: 1
Atoms: 4,150
Mol. weight: 59.01 kDa
Ligands: SRE, BOG
Released: 16 Oct 2013

Explore 4MMB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MMB contains 36 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	11-22	12
α-helix	25-37	13
α-helix	40-43	4
α-helix	44-50	7
α-helix	51-55	5
α-helix	56-70	15
α-helix	77-84	8
α-helix	88-124	37
α-helix	137-152	16
β-strand	161	1	1
α-helix	166-183	18
α-helix	187-192	6
α-helix	193-214	22
β-strand	217-218	2	2
β-strand	221-222	2	2
α-helix	223-231	9
α-helix	235-239	5
α-helix	241-254	14
α-helix	261-266	6
α-helix	276-288	13
α-helix	289-294	6
α-helix	295-306	12
α-helix	308-310	3
α-helix	311-317	7
α-helix	319-321	3
α-helix	322-326	5
α-helix	327-331	5
α-helix	337-371	35
α-helix	375-395	21
β-strand	396	1	1
α-helix	399-405	7
α-helix	406-411	6
α-helix	412-421	10
α-helix	422-426	5
α-helix	429-437	9
α-helix	443-445	3
α-helix	448-450	3
α-helix	451-455	5
α-helix	456-477	22
α-helix	483-510	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transporter	A	protein	519	Aquifex aeolicus	O67854 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MMB_1 Transporter (chains A)
MEVKREHWATRLGLILAMAGYAVDLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMW
IEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAI
KFLVGLVPEPPPNATDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINV
SILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKD
PGVWIAAVGQIFFSLGLGFGAIITFASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIP
AAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAGM
QPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTEL
IIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYIPKIMEETH
WTVWITRFYIIGLFLFLTFLVFLAERRRNHESAGTLVPR

Ligands and cofactors

ID	Name	Formula	Copies
SRE	(1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine	C17 H17 Cl2 N	1
BOG	octyl beta-D-glucopyranoside	C14 H28 O6	2

Water and common crystallization additives (NA) are not listed.

Primary citation

Structural basis for action by diverse antidepressants on biogenic amine transporters. Wang, H., Goehring, A., Wang, K.H. et al. Nature (2013) 503:141-145. DOI 10.1038/nature12648 · PubMed

Other PDB entries of the same protein (UniProt O67854 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A65 1.65 Å, Crystal structure of LEUTAA, a bacterial homolog of Na+/Cl--dependent neurotransmitter…
2Q72 1.7 Å, Crystal Structure Analysis of LeuT complexed with L-leucine, sodium, and imipramine
3F3E 1.8 Å, Crystal structure of LeuT bound to L-leucine (30 mM) and sodium
2Q6H 1.85 Å, Crystal Structure Analysis of LeuT complexed with L-leucine, sodium, and clomipramine
2QEI 1.85 Å, Crystal structure analysis of LeuT complexed with L-alanine, sodium, and clomipramine
2QB4 1.9 Å, Crystal Structure Analysis of LeuT complexed with L-leucine, sodium and desipramine
3F48 1.9 Å, Crystal structure of LeuT bound to L-alanine and sodium
3F4I 1.95 Å, Crystal Structure of LeuT bound to L-selenomethionine and sodium
3F3A 2.0 Å, Crystal Structure of LeuT bound to L-Tryptophan and Sodium
3GJD 2.0 Å, Crystal Structure of LeuT with bound OG
3F3C 2.1 Å, Crystal structure of LeuT bound to 4-Fluoro-L-Phenylalanine and sodium
3USP 2.1 Å, Crystal structure of LeuT in heptyl-beta-D-Selenoglucoside

Browse structure collections

About this viewer

MolViewer shows 4MMB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.