4MXQ: 42F3 TCR pCPC5/H-2Ld Complex

42F3 TCR pCPC5/H-2Ld Complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 19 Aug 2015.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 4,958
Mol. weight: 72.71 kDa
Released: 19 Aug 2015

Explore 4MXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MXQ contains 16 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	9
α-helix	19-20	2
β-strand	21-28	8	9
β-strand	31-37	7	9
β-strand	45-47	3	9
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	9
β-strand	109-118	10	9
β-strand	121-126	6	9
β-strand	133-135	3	9
α-helix	138-150	13
α-helix	152-160	9
α-helix	163-173	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7

Chain C: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	9-13	5	2
β-strand	18-20	3	1
β-strand	23-24	2	1
β-strand	31-37	7	2
β-strand	44-49	6	2
β-strand	55-57	3	1
β-strand	62-67	6	1
β-strand	72-77	6	1
α-helix	82-84	3
β-strand	86-93	8	2
β-strand	101-103	3	2
β-strand	107-112	6	2
β-strand	121-127	7	3
β-strand	134-139	6	3
β-strand	155-157	3	3
α-helix	158-160	3
β-strand	161-165	5	3
α-helix	166-168	3
β-strand	170-179	10	3
β-strand	199	1	3

Chain D: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-14	5	5
β-strand	19-25	7	4
β-strand	31-38	8	5
β-strand	42-50	9	5
β-strand	56-57	2	5
β-strand	65-68	4	4
β-strand	73-78	6	4
α-helix	83-85	3
β-strand	87-94	8	5
β-strand	100-102	3	5
β-strand	106-111	6	5
α-helix	114-116	3
β-strand	118	1	6
β-strand	121-126	6	3
α-helix	129-135	7
β-strand	137-147	11	3
β-strand	148	1	6
β-strand	152-158	7	7
β-strand	161-163	3	7
β-strand	167-169	3	3
α-helix	173	1
β-strand	174-175	2	3
β-strand	185-194	10	3
α-helix	195-198	4
β-strand	204-211	8	7
β-strand	214	1	8
α-helix	225-226	2
β-strand	228	1	8
β-strand	230-237	8	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
42F3 alpha VmVh chimera	C	protein	212	Mus musculus, Homo sapiens	A0A0G2JFA3, P01738 (AlphaFold model), P01848 (AlphaFold model)
42F3 beta VmVh chimera	D	protein	243	Mus musculus, Homo sapiens	A0A0A6YX08, A0A5B9
H-2 class I histocompatibility antigen, L-D alpha chain	A	protein	180	Mus musculus	P01897
pCPC5	B	protein	9

Sequence of entity 1 (C), FASTA

>4MXQ_1 42F3 alpha VmVh chimera (chains C)
GSHMAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQMLLKYYSGDPV
VQGVNGFEAEFSKSDSSFHLRKASVHWSDSAVYFCAVSAKGTGSKLSFGKGAKLTVSPNI
QNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSA
VAWSNKSDFACANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (D), FASTA

>4MXQ_2 42F3 beta VmVh chimera (chains D)
MGEAAVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIG
DVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVF
PPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQP
ALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWG
RAD

Sequence of entity 3 (A), FASTA

>4MXQ_3 H-2 class I histocompatibility antigen, L-D alpha chain (chains A)
MGPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEY
WERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYD
GCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATL

Sequence of entity 4 (B), FASTA

>4MXQ_4 pCPC5 (chains B)
SPAPRPLDL

Primary citation

Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity. Adams, J.J., Narayanan, S., Birnbaum, M.E. et al. Nat Immunol (2016) 17:87-94. DOI 10.1038/ni.3310 · PubMed

Other PDB entries of the same protein (UniProt A0A0G2JFA3), best resolution first:

4N0C 2.9 Å, 42F3 TCR pCPE3/H-2Ld complex
4N5E 3.06 Å, 42F3 TCR pCPA12/H-2Ld complex
4MVB 3.09 Å, 42F3 pCPB7/H-2Ld Complex

Browse structure collections

About this viewer

MolViewer shows 4MXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.