4MXV: Lymphotoxin alpha

Structure of Lymphotoxin alpha bound to anti-LTa Fab. Determined by X-ray diffraction at 3.2 Å resolution. Released 13 Nov 2013.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 9
Atoms: 12,881
Mol. weight: 189.81 kDa
Released: 13 Nov 2013

Explore 4MXV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MXV contains 42 α-helices and 179 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	30-35	6	1
β-strand	45-46	2	1
β-strand	53-55	3	1
β-strand	59-61	3	2
β-strand	64-66	3	2
β-strand	71-83	13	1
β-strand	97-104	8	2
β-strand	111-119	9	2
β-strand	129-141	13	1
β-strand	146-152	7	2
α-helix	154-156	3
β-strand	157	1	1
β-strand	165-170	6	1

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	30-35	6	3
β-strand	45-46	2	3
β-strand	53-55	3	3
β-strand	60-61	2	4
β-strand	64-66	3	4
α-helix	67	1
β-strand	71-83	13	3
β-strand	95-104	10	4
β-strand	111-121	11	4
β-strand	129-141	13	3
β-strand	146-152	7	4
α-helix	154-156	3
β-strand	157	1	3
β-strand	165-170	6	3

Chain D: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	30-35	6	5
β-strand	45-46	2	5
β-strand	53-55	3	5
β-strand	59-61	3	6
β-strand	64-66	3	6
α-helix	67	1
β-strand	71-83	13	5
β-strand	97-103	7	6
β-strand	112-119	8	6
β-strand	129-141	13	5
β-strand	146-152	7	6
α-helix	154-156	3
β-strand	157	1	5
β-strand	165-170	6	5

Chain E: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	29	1	9
β-strand	31	1	9
β-strand	33-38	6	8
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
β-strand	84-90	7	8
β-strand	98	1	8
β-strand	102-107	6	8
β-strand	111	1	10
α-helix	112-113	2
β-strand	114-118	5	11
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	11
β-strand	140	1	10
β-strand	145-150	6	12
β-strand	153-154	2	12
β-strand	159-163	5	11
α-helix	164-167	4
β-strand	173-182	10	11
α-helix	183-187	5
β-strand	191-197	7	12
β-strand	205-210	6	12

Chain F: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	13
β-strand	11-12	2	14
β-strand	18-25	8	13
α-helix	29-31	3
β-strand	34-39	6	15
β-strand	46-52	7	15
β-strand	56-59	4	15
β-strand	64	1	13
β-strand	67-72	6	13
β-strand	77-82	6	13
α-helix	84-86	3
β-strand	88-94	7	15
β-strand	102-103	2	15
β-strand	107-109	3	15
β-strand	110-111	2	14
β-strand	117	1	16
β-strand	120-124	5	17
β-strand	135-145	11	17
β-strand	146	1	16
β-strand	151-154	4	18
α-helix	155-157	3
β-strand	159	1	18
β-strand	163-165	3	17
α-helix	166-168	3
β-strand	169-170	2	17
β-strand	176-185	10	17
α-helix	186-188	3
β-strand	194-200	7	18
α-helix	201-203	3
β-strand	205-211	7	18

Chain H: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	24
β-strand	10-12	3	25
β-strand	17-25	9	24
α-helix	29-31	3
β-strand	34-39	6	25
β-strand	46-51	6	25
β-strand	57-59	3	25
β-strand	64	1	26
β-strand	67	1	26
β-strand	68-72	5	24
β-strand	77-82A	7	24
α-helix	84-86	3
β-strand	88-94	7	25
β-strand	102-103	2	25
β-strand	107-111	5	25
β-strand	117	1	27
β-strand	120-124	5	28
β-strand	135-145	11	28
β-strand	146	1	27
β-strand	151-154	4	29
α-helix	155-157	3
β-strand	159	1	29
β-strand	163-165	3	28
α-helix	166-168	3
β-strand	169-170	2	28
β-strand	176-185	10	28
α-helix	186-188	3
β-strand	189	1	30
β-strand	192	1	30
β-strand	194-200	7	29
α-helix	201-203	3
β-strand	205-211	7	29

Chain L: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	19
β-strand	10-14	5	20
β-strand	19-25	7	19
β-strand	33-38	6	20
β-strand	45-49	5	20
β-strand	53-54	2	20
α-helix	55	1
β-strand	62-67	6	19
β-strand	70-75	6	19
β-strand	84-90	7	20
β-strand	98	1	20
β-strand	102-107	6	20
β-strand	111	1	21
β-strand	114-118	5	22
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	22
β-strand	140	1	21
β-strand	145-150	6	23
β-strand	153-154	2	23
β-strand	159-160	2	22
β-strand	163	1	22
α-helix	165-167	3
β-strand	173-182	10	22
α-helix	183-186	4
β-strand	191-197	7	23
β-strand	205-210	6	23

Chain X: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	31
β-strand	10-13	4	32
β-strand	19-25	7	31
β-strand	29	1	33
β-strand	31	1	33
β-strand	33-38	6	32
β-strand	45-49	5	32
β-strand	53-54	2	32
α-helix	55	1
β-strand	62-67	6	31
β-strand	70-75	6	31
β-strand	85-90	6	32
β-strand	98	1	32
β-strand	102-106	5	32
β-strand	111	1	34
β-strand	114-118	5	35
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	35
β-strand	140	1	34
β-strand	144-150	7	36
β-strand	153-154	2	36
α-helix	155	1
β-strand	159-163	5	35
α-helix	164-167	4
β-strand	173-182	10	35
α-helix	183-188	6
β-strand	191-198	8	36
β-strand	205-210	6	36

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lymphotoxin-alpha	A, B, D	protein	157	Homo sapiens	P01374 (AlphaFold model)
anti-Lymphotoxin alpha antibody light chain	E, L, X	protein	211	Homo sapiens
anti-Lymphotoxin alpha antibody heavy chain	F, H, Y	protein	213	Homo sapiens

Sequence of entity 1 (A, B, D), FASTA

>4MXV_1 Lymphotoxin-alpha (chains A, B, D)
ADLGSDYKDDDDKKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYF
VYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMY
HGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Sequence of entity 2 (E, L, X), FASTA

>4MXV_2 anti-Lymphotoxin alpha antibody light chain (chains E, L, X)
DIQMTQSPSSLSASVGDRVTITCRASQAVSSAVAWYQQKPGKAPKLLIYSASHRYTGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQESYSTPWTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR

Sequence of entity 3 (F, H, Y), FASTA

>4MXV_3 anti-Lymphotoxin alpha antibody heavy chain (chains F, H, Y)
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYVIHWVRQAPGKGLEWVGYNNPYNAGTNY
NEKFKGRFTISSDKSKNTAYLQMNSLRAEDTAVYYCSRPTMLPWFAYWGQGTLVTVSSAS
TKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV
VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

Primary citation

Dimerization of LT beta R by LT alpha 1 beta 2 is necessary and sufficient for signal transduction. Sudhamsu, J., Yin, J., Chiang, E.Y. et al. Proc Natl Acad Sci U S A (2013) 110:19896-19901. DOI 10.1073/pnas.1310838110 · PubMed

Other PDB entries of the same protein (UniProt P01374 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TNR 2.85 Å, Crystal structure of the soluble human 55 kd tnf receptor-human tnf-beta complex:…
4MXW 3.6 Å, Structure of heterotrimeric lymphotoxin LTa1b2 bound to lymphotoxin beta receptor LTbR…

Browse structure collections

About this viewer

MolViewer shows 4MXV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.