4MYT: Elongation factor G

Crystal structure of elongation factor G (EFG). Determined by X-ray diffraction at 3.5 Å resolution. Released 6 Aug 2014.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Thermus thermophilus
Chains: 1
Atoms: 5,130
Mol. weight: 77.39 kDa
Ligands: GDP, MG
Released: 6 Aug 2014

Explore 4MYT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4MYT contains 24 α-helices and 52 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 52 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	15	1	1
β-strand	17-19	3	2
α-helix	25-36	12
β-strand	69-70	2	1
β-strand	73-74	2	3
β-strand	77-78	2	3
β-strand	81-82	2	1
α-helix	83-84	2
α-helix	88-90	3
α-helix	92-100	9
β-strand	105-109	5	2
α-helix	116-127	12
β-strand	133-137	5	2
α-helix	146-157	12
β-strand	162-163	2	2
β-strand	165-167	3	4
β-strand	176-179	4	4
β-strand	184-187	4	4
β-strand	197-199	3	4
α-helix	206-220	15
α-helix	225-232	8
α-helix	239-251	13
β-strand	257-260	4	2
β-strand	262	1	5
β-strand	267	1	5
α-helix	269-278	10
α-helix	281-282	2
α-helix	287-288	2
β-strand	289-290	2	6
β-strand	292	1	7
β-strand	300-301	2	6
β-strand	310-318	9	8
β-strand	324-332	9	8
β-strand	335-336	2	9
β-strand	340-343	4	8
β-strand	349-356	8	8
β-strand	365-366	2	8
β-strand	368-369	2	9
β-strand	374-379	6	8
β-strand	388-391	4	8
β-strand	398	1	7
β-strand	409-415	7	10
α-helix	422-433	12
β-strand	439-442	4	10
β-strand	449-453	5	10
α-helix	457-466	10
β-strand	474-476	3	10
β-strand	480-481	2	10
β-strand	484-486	3	11
β-strand	491	1	12
β-strand	494-495	2	12
β-strand	498	1	13
β-strand	507	1	13
β-strand	509-516	8	12
α-helix	517-518	2
β-strand	523-527	5	12
α-helix	536-538	3
α-helix	539-549	11
β-strand	560	1	11
β-strand	563-571	9	12
β-strand	577	1	13
α-helix	583-594	12
β-strand	600-605	6	11
β-strand	608-612	5	14
α-helix	617-624	8
β-strand	634-637	4	14
β-strand	640-645	6	14
β-strand	648	1	11
α-helix	649-651	3
α-helix	655-660	6
β-strand	668	1	14
β-strand	671	1	14
β-strand	675-678	4	11
α-helix	679-680	2
α-helix	681-686	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor G	A	protein	691	Thermus thermophilus	P13551 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4MYT_1 Elongation factor G (chains A)
MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERE
RGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSET
VWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDV
LRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEE
ELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVE
IHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHA
NHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKAD
QEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQ
VAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIP
AVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSAMAFKIAGSMAIKEAVQKGDPV
ILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLR
SKTQGRGSFVMFFDHYQEVPKQVQEKLIKGQ

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
MG	Magnesium ion	Mg	1

Primary citation

Crystal structure of elongation factor G (EFG). Liu, G., Dong, J., Gong, W. et al. To be published.

Other PDB entries of the same protein (UniProt P13551 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BM0 2.4 Å, Ribosomal elongation factor G (EF-G) Fusidic acid resistant mutant T84A
2BV3 2.5 Å, Crystal structure of a mutant elongation factor G trapped with a GTP analogue
2BM1 2.6 Å, Ribosomal elongation factor G (EF-G) Fusidic acid resistant mutant G16V
1FNM 2.8 Å, Structure of thermus thermophilus ef-G H573A
2J7K 2.9 Å, Crystal structure of the T84A mutant EF-G:GDPCP complex
4M1K 2.95 Å, Crystal structure of elongation factor G (EFG)
4MYU 3.0 Å, Crystal structure of elongation factor G mutant(EFG)
1KTV 3.8 Å, Crystal Structure of Elongation Factor G Dimer Without Nucleotide
1PN6 10.8 Å, Domain-wise fitting of the crystal structure of T.thermophilus EF-G into the low…
2BCW 11.2 Å, Coordinates of the N-terminal domain of ribosomal protein L11,C-terminal domain of…
1JQM 18.0 Å, Fitting of L11 protein and elongation factor G (EF-G) in the cryo-em map of e. coli 70S…
1JQS 18.0 Å, Fitting of L11 protein and elongation factor G (domain G' and V) in the cryo-em map of…

Browse structure collections

About this viewer

MolViewer shows 4MYT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.