4N3X: Rabex-5 CC domain

Crystal structure of Rabex-5 CC domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Jul 2014.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,726
Mol. weight: 24.33 kDa
Released: 23 Jul 2014

Explore 4N3X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N3X contains 5 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-11	10
α-helix	13-48	36

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-50	49

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-46	41

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-48	45

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rab5 GDP/GTP exchange factor	A, B, C, D	protein	51	Homo sapiens	Q9UJ41 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4N3X_1 Rab5 GDP/GTP exchange factor (chains A, B, C, D)
GSHMQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEK

Primary citation

Molecular mechanism for Rabex-5 GEF activation by Rabaptin-5. Zhang, Z., Zhang, T., Wang, S. et al. Elife (2014) 3:e02687-e02687. DOI 10.7554/eLife.02687 · PubMed

Other PDB entries of the same protein (UniProt Q9UJ41 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C7N 2.1 Å, Human Rabex-5 residues 1-74 in complex with Ubiquitin
2OT3 2.1 Å, Crystal structure of rabex-5 VPS9 domain in complex with nucleotide free RAB21
4N3Y 2.2 Å, Crystal structure of Rabex-5CC and Rabaptin-5C21 complex
1TXU 2.35 Å, Crystal Structure of the Vps9 Domain of Rabex-5
2C7M 2.4 Å, Human Rabex-5 residues 1-74 in complex with Ubiquitin
4N3Z 3.1 Å, Crystal structure of Rabex-5delta and Rabaptin-5C21 complex
4Q9U 4.62 Å, Crystal structure of the Rab5, Rabex-5delta and Rabaptin-5C21 complex

Browse structure collections

About this viewer

MolViewer shows 4N3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.