Crystal structure of human Striatin-3 coiled coil domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Feb 2014.
Explore 4N6J in 3D Show helices and sheets RCSB PDB PDBe
4N6J contains 3 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 84-129 | 46 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 85-102 | 18 | |
| α-helix | 104-129 | 26 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Striatin-3 | A, B | protein | 50 | Homo sapiens | Q13033 (AlphaFold model) |
>4N6J_1 Striatin-3 (chains A, B) STMDWEVERAELQARIAMLQGERKGQENLKKDLVRRIKMLEMALKQERAK
Striatins contain a noncanonical coiled coil that binds protein phosphatase 2A A subunit to form a 2:2 heterotetrameric core of striatin-interacting phosphatase and kinase (STRIPAK) complex. Chen, C., Shi, Z., Zhang, W. et al. J Biol Chem (2014) 289:9651-9661. DOI 10.1074/jbc.M113.529297 · PubMed
Other PDB entries of the same protein (UniProt Q13033 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4N6J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.