4NAC: N-terminal Domain of p15RS

Crystal Structure of the N-terminal Domain of p15RS. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Dec 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,427
Mol. weight: 32.64 kDa
Released: 11 Dec 2013

Explore 4NAC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NAC contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	6-14	9
α-helix	20-32	13
α-helix	34-36	3
α-helix	37-50	14
α-helix	53-70	18
α-helix	76-95	20
α-helix	98-100	3
α-helix	101-113	13
α-helix	119-130	12
α-helix	132-135	4

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	6-15	10
α-helix	20-32	13
α-helix	34-36	3
α-helix	37-50	14
α-helix	53-70	18
α-helix	76-94	19
α-helix	98-113	16
α-helix	119-130	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulation of nuclear pre-mRNA domain-containing protein 1A	A, B	protein	139	Homo sapiens	Q96P16 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4NAC_1 Regulation of nuclear pre-mRNA domain-containing protein 1A (chains A, B)
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFL
YLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYEND
VLEQLKQALYGLEHHHHHH

Primary citation

Crystal Structure of the N-terminal Domain of p15RS. Mei, K., Jin, Z., Ren, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q96P16 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JXT 1.9 Å, CID of human RPRD1A in complex with a phosphorylated peptide from RPB1-CTD

Browse structure collections

About this viewer

MolViewer shows 4NAC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.