4NFT: Human lnkH2B-h2A.Z-Anp32e

Name: PDB 4NFT: Crystal structure of human lnkH2B-h2A.Z-Anp32e
Published: 2014-04-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of human lnkH2B-h2A.Z-Anp32e. Determined by X-ray diffraction at 2.61 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,932
Mol. weight: 102.09 kDa
Released: 9 Apr 2014

Explore 4NFT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NFT contains 40 α-helices and 16 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	22-23	2	1
α-helix	25-50	26
β-strand	57-58	2	2
α-helix	60-70	11
α-helix	73-91	19
α-helix	99-103	5
α-helix	109-117	9
β-strand	125-126	2	2
α-helix	130-155	26
β-strand	160-161	2	1
α-helix	163-171	9
α-helix	174-184	11

Chain C: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	22-23	2	5
α-helix	25-49	25
α-helix	54-56	3
β-strand	58	1	6
α-helix	60-70	11
α-helix	73-90	18
α-helix	99-103	5
α-helix	109-119	11
β-strand	126	1	6
α-helix	130-155	26
β-strand	160-161	2	5
α-helix	163-171	9
α-helix	174-185	12

Chain D: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	22-23	2	7
α-helix	25-49	25
α-helix	54-56	3
β-strand	58	1	8
α-helix	60-70	11
α-helix	73-91	19
α-helix	99-103	5
α-helix	109-119	11
β-strand	126	1	8
α-helix	130-155	26
β-strand	160-161	2	7
α-helix	163-171	9
α-helix	174-185	12

Chains E and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	10-14	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H2B type 2-E, Histone H2A.Z	A, B, C, D	protein	209	Homo sapiens	P0C0S5 (AlphaFold model), Q16778 (AlphaFold model)
Acidic leucine-rich nuclear phosphoprotein 32 family member E	E, F	protein	52	Homo sapiens	Q9BTT0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4NFT_1 Histone H2B type 2-E, Histone H2A.Z (chains A, B, C, D)
GSHMRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRST
ITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKAVSRSQRAGLQFPVGRIHRHLK
SRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELD
SLIKATIAGGGVIPHISGSGGSGGGLVPR

Sequence of entity 2 (E, F), FASTA

>4NFT_2 Acidic leucine-rich nuclear phosphoprotein 32 family member E (chains E, F)
GSHMEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDD

Primary citation

Anp32e, a higher eukaryotic histone chaperone directs preferential recognition for H2A.Z. Mao, Z., Pan, L., Wang, W. et al. Cell Res (2014) 24:389-399. DOI 10.1038/cr.2014.30 · PubMed

Other PDB entries of the same protein (UniProt P0C0S5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CAY 1.48 Å, Crystal structure of a human Anp32e-H2A.Z-H2B complex
6KO2 1.5 Å, Crystal Structure of BRD4-Brmo2 in complex with H2A.ZK4acK7ac peptide
5CHL 1.89 Å, Structural basis of H2A.Z recognition by YL1 histone chaperone component of SRCAP/SWR1…
9INC 2.01 Å, High resolutional Crystal Structure of human H2A.Z-H2B dimer in complex with human YL1-Z…
6JOU 2.17 Å, Crystal structure of the human nucleosome containing H2A.Z.1 S42R
5B31 2.2 Å, The crystal structure of the heterotypic H2AZ/H2A nucleosome with H3.1.
5B32 2.35 Å, The crystal structure of the heterotypic H2AZ/H2A nucleosome with H3.3.
5Z30 2.45 Å, The crystal structure of the nucleosome containing a cancer-associated histone H2A.Z…
9UBD 2.53 Å, The Structural Basis of the Recognition of the Histone Variant H2A.Z by the SRCAP…
1F66 2.6 Å, 2.6 a crystal structure of a nucleosome core particle containing the variant histone H2A.Z
8T9F 2.6 Å, Catalytic and non-catalytic mechanisms of histone H4 lysine 20 methyltransferase SUV420H1
5FUG 2.7 Å, Crystal structure of a human YL1-H2A.Z-H2B complex

Browse structure collections

About this viewer

MolViewer shows 4NFT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.