Protein Crystal Structure of Human Borjeson-Forssman-Lehmann Syndrome Associated Protein PHF6. Determined by X-ray diffraction at 1.47 Å resolution. Released 26 Feb 2014.
Explore 4NN2 in 3D Show helices and sheets RCSB PDB PDBe
4NN2 contains 15 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 219-221 | 3 | |
| α-helix | 222-225 | 4 | |
| α-helix | 227 | 1 | |
| β-strand | 228-230 | 3 | 1 |
| β-strand | 237-239 | 3 | 1 |
| α-helix | 240-244 | 5 | |
| α-helix | 249-250 | 2 | |
| β-strand | 251 | 1 | 2 |
| β-strand | 263 | 1 | 2 |
| α-helix | 265-275 | 11 | |
| β-strand | 290-291 | 2 | 3 |
| β-strand | 292 | 1 | 4 |
| β-strand | 300-301 | 2 | 3 |
| α-helix | 303-308 | 6 | |
| β-strand | 312-316 | 5 | 4 |
| β-strand | 321-325 | 5 | 4 |
| α-helix | 327-329 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 219-221 | 3 | |
| α-helix | 222-225 | 4 | |
| β-strand | 228-230 | 3 | 5 |
| β-strand | 237-239 | 3 | 5 |
| α-helix | 240-245 | 6 | |
| α-helix | 249-250 | 2 | |
| β-strand | 251 | 1 | 6 |
| β-strand | 263 | 1 | 6 |
| α-helix | 265-275 | 11 | |
| β-strand | 290-291 | 2 | 7 |
| β-strand | 292 | 1 | 8 |
| β-strand | 300-301 | 2 | 7 |
| α-helix | 303-308 | 6 | |
| β-strand | 312-316 | 5 | 8 |
| α-helix | 317-319 | 3 | |
| β-strand | 321-325 | 5 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein 6 | A, B | protein | 129 | Homo sapiens | Q8IWS0 (AlphaFold model) |
>4NN2_1 PHD finger protein 6 (chains A, B) GPSTRPKCGFCHVGEEENEARGKLHIFNAKKAAAHYKCMLFSSGTVQLTTTSRAEFGDFD IKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKTYHYHCGVQDKAKYIENMSRGIYKL YCKNHSGND
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 6 |
Water and common crystallization additives (GOL) are not listed.
Crystal Structure of the second extended PHD domain of human PHF6 protein. Liu, Z., Li, F., Zhang, J. et al. J Biol Chem (2014).
Other PDB entries of the same protein (UniProt Q8IWS0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.