4NND: PDB entry 4NND

Structural basis of PTPN18 fingerprint on distinct HER2 tyrosine phosphorylation sites. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Nov 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 8
Atoms: 9,330
Mol. weight: 135.81 kDa
Released: 19 Nov 2014

Explore 4NND in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NND contains 56 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
α-helix	27-42	16
α-helix	49-52	4
α-helix	57-59	3
α-helix	69-71	3
β-strand	72-74	3	1
α-helix	79-81	3
β-strand	86-93	8	1
β-strand	99-104	6	1
α-helix	105-108	4
α-helix	109-111	3
α-helix	112-121	10
β-strand	126-129	4	1
β-strand	134	1	2
β-strand	139	1	2
α-helix	146	1
β-strand	147	1	3
β-strand	150	1	3
β-strand	152-154	3	1
β-strand	157-168	12	1
β-strand	171-180	10	1
β-strand	183-192	10	1
α-helix	204-218	15
α-helix	223-224	2
β-strand	225-228	4	1
α-helix	234-250	17
α-helix	260-270	11
α-helix	278-293	16

Chain D: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-14	8
α-helix	27-43	17
α-helix	57-59	3
α-helix	69-71	3
β-strand	72-74	3	7
β-strand	86-93	8	7
β-strand	99-104	6	7
α-helix	105-108	4
α-helix	109-111	3
α-helix	112-121	10
β-strand	126-129	4	7
β-strand	134	1	8
β-strand	139	1	8
α-helix	146	1
β-strand	147	1	9
β-strand	150	1	9
β-strand	152-154	3	7
β-strand	157-168	12	7
β-strand	171-180	10	7
β-strand	183-192	10	7
α-helix	204-218	15
α-helix	223-224	2
β-strand	225-228	4	7
α-helix	234-250	17
α-helix	260-270	11
α-helix	278-293	16

Chain G: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-13	7
α-helix	27-42	16
α-helix	49-52	4
α-helix	57-59	3
α-helix	69-71	3
β-strand	72-74	3	10
β-strand	86-93	8	10
β-strand	99-104	6	10
α-helix	105-108	4
α-helix	109-111	3
α-helix	112-121	10
β-strand	126-129	4	10
β-strand	134	1	11
β-strand	139	1	11
β-strand	147	1	12
β-strand	150	1	12
β-strand	152-154	3	10
β-strand	157-168	12	10
β-strand	171-180	10	10
β-strand	183-192	10	10
α-helix	204-218	15
α-helix	224	1
β-strand	225-228	4	10
α-helix	234-250	17
α-helix	260-270	11
α-helix	278-293	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 18	A, B, D, G	protein	290	Homo sapiens	Q99952 (AlphaFold model)
Receptor tyrosine-protein kinase erbB-2	C, E, F, H	protein	6	Homo sapiens	P04626 (AlphaFold model)

Sequence of entity 1 (A, B, D, G), FASTA

>4NND_1 Tyrosine-protein phosphatase non-receptor type 18 (chains A, B, D, G)
DSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYKDV
LPYDQTRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVWEFGVK
VILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESR
SVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHSSAGCGRTGVLCTVDYV
RQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCST

Sequence of entity 2 (C, E, F, H), FASTA

>4NND_2 Receptor tyrosine-protein kinase erbB-2 (chains C, E, F, H)
LQRYSE

Primary citation

Structural basis of PTPN18 fingerprint on distinct HER2 tyrosine phosphorylation sites. Wang, H., Yang, F., Yang, D. et al. To be published.

Other PDB entries of the same protein (UniProt Q99952 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OC3 1.5 Å, Crystal Structure of the Catalytic Domain of Human Protein Tyrosine Phosphatase…
4GFU 2.0 Å, PTPN18 in complex with HER2-pY1248 phosphor-peptides
4GFV 2.1 Å, PTPN18 in complex with HER2-pY1196 phosphor-peptides

Browse structure collections

About this viewer

MolViewer shows 4NND directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.