4NQ0: HAT1-interacting factor 1

Name: PDB 4NQ0: Structural insights into yeast histone chaperone Hif1: a scaffold protein recruiting protein complexes to core histones
Published: 2014-07-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Structural insights into yeast histone chaperone Hif1: a scaffold protein recruiting protein complexes to core histones. Determined by X-ray diffraction at 2.1 Å resolution. Released 16 Jul 2014.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,089
Mol. weight: 44.55 kDa
Released: 16 Jul 2014

Explore 4NQ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NQ0 contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	14-34	21
α-helix	38-51	14
α-helix	58-60	3
α-helix	61-77	17
α-helix	161-163	3
α-helix	165-166	2
α-helix	167-171	5
α-helix	174-177	4
α-helix	186-188	3
α-helix	194-198	5
α-helix	202-218	17
α-helix	225-228	4
α-helix	229-248	20
α-helix	252-266	15
α-helix	270-271	2
α-helix	273-290	18
α-helix	298-316	19
α-helix	323-339	17
α-helix	340-344	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HAT1-interacting factor 1	A	protein	393	Saccharomyces cerevisiae	Q12373 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4NQ0_1 HAT1-interacting factor 1 (chains A)
MKLRAEDVLANGTSRHKVQIDMERQVQIAKDLLAQKKFLEAAKRCQQTLDSLPKDGLLPD
PELFTIFAQAVYNMEVQNSGNLFGDALLAGDDGSGSESESEPESDVSNGEEGNENGQTEI
PNSRMFQFDQEEEDLTGDVDSGDSEDSGEGSEEEEENVEKEEERLALHELANFSPANEHD
DEIEDVSQLRKSGFHIYFENDLYENALDLLAQALMLLGRPTADGQSLTENSRLRIGDVYI
LMGDIEREAEMFSRAIHHYLKALGYYKTLKPAEQVTEKVIQAEFLVCDALRWVDQVPAKD
KLKRFKHAKALLEKHMTTRPKDSELQQARLAQIQDDIDEVQENQQHGSKRPLSQPTTSIG
FPALEKPLGDFNDLSQLVKKKPRRHLEHHHHHH

Primary citation

Structural insights into yeast histone chaperone Hif1: a scaffold protein recruiting protein complexes to core histones. Liu, H., Zhang, M., He, W. et al. Biochem J (2014) 462:465-473. DOI 10.1042/BJ20131640 · PubMed

Other PDB entries of the same protein (UniProt Q12373 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BT1 2.62 Å, histone chaperone Hif1 playing with histone H2A-H2B dimer

Browse structure collections

About this viewer

MolViewer shows 4NQ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.