4NRH: CopN-Scc3 complex

CopN-Scc3 complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Oct 2014.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Chlamydia pneumoniae
Chains: 4
Atoms: 7,681
Mol. weight: 112.86 kDa
Released: 15 Oct 2014

Explore 4NRH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NRH contains 56 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	96-102	7
α-helix	109-118	10
α-helix	125-135	11
α-helix	139-152	14
α-helix	155-157	3
α-helix	158-175	18
α-helix	177-183	7
α-helix	186-193	8
α-helix	200-211	12
α-helix	217-227	11
α-helix	230-250	21
α-helix	257-293	37
α-helix	304-315	12
α-helix	322-333	12
α-helix	337-350	14
α-helix	356-358	3
α-helix	362-379	18

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-13	11
α-helix	25-29	5
α-helix	43-46	4
α-helix	51-66	16
α-helix	70-83	14
α-helix	88-100	13
α-helix	104-117	14
α-helix	123-134	12
α-helix	138-152	15
α-helix	156-158	3
α-helix	159-168	10

Chain D: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-13	11
α-helix	25-29	5
α-helix	43-46	4
α-helix	51-66	16
α-helix	70-83	14
α-helix	88-100	13
α-helix	104-117	14
α-helix	123-134	12
α-helix	141-152	12
α-helix	156-158	3
α-helix	159-168	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CopN	A, C	protein	321	Chlamydia pneumoniae	Q9Z8L4 (AlphaFold model)
Chaperone SycD	B, D	protein	178	Chlamydia pneumoniae	Q9Z6N8 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4NRH_1 CopN (chains A, C)
GSHMASSESTEEKPDTDLADKYASGNSEISGQELRGLRDAIGDDASPEDILALVQEKIKD
PALQSTALDYLVQTTPPSQGKLKEALIQARNTHTEQFGRTAIGAKNILFASQEYADQLNV
SPSGLRSLYLEVTGDTHTCDQLLSMLQDRYTYQDMAIVSSFLMKGMATGLKRQGPYVPSA
QLQVLMTETRNLQAVLTSYDYFESRVPILLDSLKAEGIQTPSDLNFVKVAESYHKIINDK
FPTASKVEREVRNLIGDDVDSVTGVLNLFFSALRQTSSRLFSSADKRQQLGAMIANALDA
VNINNEDYPKASDFPKPYPWS

Sequence of entity 2 (B, D), FASTA

>4NRH_2 Chaperone SycD (chains B, D)
GSHMASMSHLNYLLEKIAASSKEDFPFPDDLESYLEGYVPDKNIALDTYQKIFKISSEDL
EKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVT
AVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRKHK

Primary citation

A gatekeeper chaperone complex directs translocator secretion during type three secretion. Archuleta, T.L., Spiller, B.W. PLoS Pathog (2014) 10:e1004498-e1004498. DOI 10.1371/journal.ppat.1004498 · PubMed

Other PDB entries of the same protein (UniProt Q9Z8L4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4P40 1.2 Å, Chlamydia pneumoniae CopN
4P3Z 1.77 Å, Chlamydia pneumoniae CopN (D29 construct)
6GX7 3.19 Å, Tubulin-CopN-alphaRep complex

Browse structure collections

About this viewer

MolViewer shows 4NRH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.