CW-type zinc finger of ZCWPW2 in complex with the amino terminus of histone H3. Determined by X-ray diffraction at 1.78 Å resolution. Released 26 Mar 2014.
Explore 4O62 in 3D Show helices and sheets RCSB PDB PDBe
4O62 contains 12 α-helices and 9 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28 | 1 | 1 |
| β-strand | 30-32 | 3 | 2 |
| β-strand | 41-43 | 3 | 2 |
| α-helix | 44-45 | 2 | |
| α-helix | 46-51 | 6 | |
| α-helix | 60-62 | 3 | |
| α-helix | 74-76 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-28 | 3 | |
| β-strand | 29-32 | 4 | 3 |
| β-strand | 41-43 | 3 | 3 |
| α-helix | 46-51 | 6 | |
| α-helix | 60-62 | 3 | |
| α-helix | 74-77 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Zinc finger CW-type PWWP domain protein 2 | A, B, C | protein | 59 | Homo sapiens | Q504Y3 (AlphaFold model) |
| Histone H3.3 | D | protein | 11 | Homo sapiens | P84243 (AlphaFold model) |
>4O62_1 Zinc finger CW-type PWWP domain protein 2 (chains A, B, C) GVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNCSISEEDF
>4O62_2 Histone H3.3 (chains D) ARTKQTARKST
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (UNX) are not listed.
Family-wide Characterization of Histone Binding Abilities of Human CW Domain-containing Proteins. Liu, Y., Tempel, W., Zhang, Q. et al. J Biol Chem (2016) 291:9000-9013. DOI 10.1074/jbc.M116.718973 · PubMed
Other PDB entries of the same protein (UniProt Q504Y3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4O62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.