4OAA: E. coli lactose permease G46W,G262W

Crystal structure of E. coli lactose permease G46W,G262W bound to sugar. Determined by X-ray diffraction at 3.5 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Escherichia coli
Chains: 2
Atoms: 6,257
Mol. weight: 94.3 kDa
Released: 29 Jan 2014

Explore 4OAA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OAA contains 62 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	7-24	18
α-helix	30-32	3
α-helix	33-37	5
α-helix	49-57	9
α-helix	60-68	9
α-helix	75-83	9
α-helix	84-86	3
α-helix	87-89	3
α-helix	90-94	5
α-helix	95-101	7
α-helix	104-108	5
α-helix	109-112	4
α-helix	113-114	2
α-helix	115-119	5
α-helix	122-135	14
α-helix	140-164	25
α-helix	168-185	18
α-helix	210-217	8
α-helix	220-228	9
α-helix	229-233	5
α-helix	234-239	6
α-helix	243-248	6
α-helix	254-286	33
α-helix	289-307	19
α-helix	312-340	29
α-helix	343-345	3
α-helix	346-349	4
α-helix	350-356	7
α-helix	357-373	17
α-helix	379-395	17
α-helix	405-408	4

Chain B: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	7-24	18
α-helix	30-32	3
α-helix	33-38	6
α-helix	45-52	8
α-helix	56-69	14
α-helix	75-83	9
α-helix	84-86	3
α-helix	87-89	3
α-helix	90-94	5
α-helix	95-100	6
α-helix	104-108	5
α-helix	109-111	3
α-helix	113-114	2
α-helix	115-119	5
α-helix	121-135	15
α-helix	140-165	26
α-helix	168-186	19
α-helix	211-218	8
α-helix	220-228	9
α-helix	229-233	5
α-helix	234-239	6
α-helix	243-248	6
α-helix	254-286	33
α-helix	289-305	17
α-helix	312-338	27
α-helix	343-345	3
α-helix	346-350	5
α-helix	352-357	6
α-helix	358-376	19
α-helix	378-399	22
α-helix	405-409	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lactose/galactose transporter	A, B	protein	417	Escherichia coli	P02920 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4OAA_1 Lactose/galactose transporter (chains A, B)
MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTWIIFAAISLFSLLFQ
PLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFCFNA
GAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFTINNQFVFWLGSGCALIL
AVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSCTYDVFD
QQFANFFTSFFATGEQGTRVFWYVTTMGELLNASIMFFAPLIINRIGGKNALLLAGTIMS
VRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQFEVRFSATIYLVCFCFFKQL
AMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTLSGPGPLSLLRRQVNEVA

Primary citation

Structure of sugar-bound LacY. Kumar, H., Kasho, V., Smirnova, I. et al. Proc Natl Acad Sci U S A (2014) 111:1784-1788. DOI 10.1073/pnas.1324141111 · PubMed

Other PDB entries of the same protein (UniProt P02920 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XOU 2.5 Å, CryoEM structure of LacY with Trimbody
6VBG 2.8 Å, Lactose permease complex with thiodigalactoside and nanobody 9043
2CFQ 2.95 Å, Sugar Free Lactose Permease at neutral pH
8YA0 2.97 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)
6C9W 3.0 Å, Crystal Structure of a ligand bound LacY/Nanobody Complex
8YA3 3.27 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C) treated with DTT
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
2CFP 3.3 Å, Sugar Free Lactose Permease at acidic pH
5GXB 3.3 Å, crystal structure of a LacY/Nanobody complex
4ZYR 3.31 Å, Crystal structure of E. coli Lactose permease G46W/G262W bound to p-nitrophenyl…
2Y5Y 3.38 Å, Crystal structure of LacY in complex with an affinity inactivator
1PV6 3.5 Å, Crystal structure of lactose permease

Browse structure collections

About this viewer

MolViewer shows 4OAA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.