4OUN: Mini-ribonuclease 3 from Bacillus subtilis

Crystal Structure of Mini-ribonuclease 3 from Bacillus subtilis. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Feb 2015.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Bacillus subtilis subsp. subtilis
Chains: 1
Atoms: 1,045
Mol. weight: 18.42 kDa
Released: 4 Feb 2015

Explore 4OUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OUN contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	30-32	3
α-helix	35-56	22
α-helix	62-73	12
α-helix	75-87	13
α-helix	93-103	11
α-helix	116-134	19
α-helix	138-153	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mini-ribonuclease 3	A	protein	163	Bacillus subtilis subsp. subtilis	O31418 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4OUN_1 Mini-ribonuclease 3 (chains A)
MGSSHHHHHHSSGLVPRGSHMLEFDTIKDSKQLNGLALAYIGDAIFEVYVRHHLLKQGFT
KPNDLHKKSSRIVSAKSQAEILFFLQNQSFFTEEEEAVLKRGRNAKSGTTPKNTDVQTYR
YSTAFQALLGYLFLEKKEERLSQLVAEAIQFGTSGRKTNESAT

Primary citation

Sequence-specific cleavage of dsRNA by Mini-III RNase. Glow, D., Pianka, D., Sulej, A.A. et al. Nucleic Acids Res (2015) 43:2864-2873. DOI 10.1093/nar/gkv009 · PubMed

Other PDB entries of the same protein (UniProt O31418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TNN 3.07 Å, Mini-RNase III (Mini-III) bound to 50S ribosome with precursor 23S rRNA

Browse structure collections

About this viewer

MolViewer shows 4OUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.