4OWF: NEMO CoZi

Crystal structure of the NEMO CoZi in complex with HOIP NZF1 domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Feb 2014.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 1,743
Mol. weight: 24.68 kDa
Ligands: ZN
Released: 12 Feb 2014

Explore 4OWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OWF contains 4 α-helices and 4 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	253-289	37
α-helix	291-333	43

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	252-289	38
α-helix	291-335	45

Chain G: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	354-355	2	1
β-strand	362-363	2	1
β-strand	369	1	2
β-strand	376	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NF-kappa-B essential modulator	A, B	protein	90	Mus musculus	O88522 (AlphaFold model)
E3 ubiquitin-protein ligase RNF31	G	protein	30	Homo sapiens	Q96EP0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4OWF_1 NF-kappa-B essential modulator (chains A, B)
GMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAER
HAREKLVEKKEYLQEQLEQLQREFNKLKVG

Sequence of entity 2 (G), FASTA

>4OWF_2 E3 ubiquitin-protein ligase RNF31 (chains G)
ARGRWACQSCTFENEAAAVLCSICERPRLA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Mechanism Underlying I kappa B Kinase Activation Mediated by the Linear Ubiquitin Chain Assembly Complex. Fujita, H., Rahighi, S., Akita, M. et al. Mol Cell Biol (2014) 34:1322-1335. DOI 10.1128/MCB.01538-13 · PubMed

Other PDB entries of the same protein (UniProt O88522 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JSV 2.7 Å, Crystal structure of mouse NEMO CoZi in complex with Lys63-linked di-ubiquitin
3F89 2.8 Å, NEMO CoZi domain
2V4H 2.9 Å, NEMO CC2-LZ domain - 1D5 DARPin complex
2ZVO 2.9 Å, NEMO CoZi domain in complex with diubiquitin in C2 space group
2ZVN 3.0 Å, NEMO CoZi domain incomplex with diubiquitin in P212121 space group

Browse structure collections

About this viewer

MolViewer shows 4OWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.