4P5I: Chemokine binding protein from orf virus

Crystal structure of the chemokine binding protein from orf virus. Determined by X-ray diffraction at 2.25 Å resolution. Released 15 Jul 2015.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Orf virus
Chains: 1
Atoms: 2,081
Mol. weight: 30.23 kDa
Ligands: NAG
Released: 15 Jul 2015

Explore 4P5I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P5I contains 8 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	12-20	9
β-strand	27-37	11	1
β-strand	50-59	10	2
α-helix	65	1
β-strand	66-76	11	2
β-strand	79-88	10	2
β-strand	94-101	8	1
β-strand	108-116	9	1
α-helix	117-118	2
α-helix	129-141	13
β-strand	143-149	7	2
α-helix	200	1
β-strand	201-202	2	1
α-helix	203	1
β-strand	205-209	5	2
β-strand	214-225	12	1
α-helix	228-230	3
β-strand	237-242	6	1
α-helix	245-251	7
β-strand	260-265	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chemokine binding protein	A	protein	270	Orf virus	Q2F862

Sequence of entity 1 (A), FASTA

>4P5I_1 Chemokine binding protein (chains A)
APLLESQRSNSEEKANFCSTHNDEVYARFRLQMRVGVRHSPLYTPSNMCMLDIEDSVEDI
EESTEKEYASTATGEAAGVNVSVALVGEGVSIPFSYIGLGFNPSLEDSYLYVNVSSRAPW
VKQTSDLSANGGWGIKQVLEKELLAIQIGCDNQKFPEEPTTTPPSPVTTTLSSTTPDLNE
ENTENTPTTTGASVDRKRNPADIDFSLLVDPRCVTSVDLHVELRDACIDYKQESPLSLKG
KYGDGELVKKEIKDVGKNHNMCSLNLNPGN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Structures of Orf Virus Chemokine Binding Protein in Complex with Host Chemokines Reveal Clues to Broad Binding Specificity. Counago, R.M., Knapp, K.M., Nakatani, Y. et al. Structure (2015) 23:1199-1213. DOI 10.1016/j.str.2015.04.023 · PubMed

Other PDB entries of the same protein (UniProt Q2F862), best resolution first:

4ZK9 2.6 Å, The chemokine binding protein of orf virus complexed with CCL2
4ZKB 2.9 Å, The chemokine binding protein of orf virus complexed with CCL3
4ZKC 3.15 Å, The chemokine binding protein of orf virus complexed with CCL7

Browse structure collections

About this viewer

MolViewer shows 4P5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.