4PB0: Ab53 heavy chain

Structure of the Fab fragment of the anti-Francisella tularensis GroEL antibody Ab53. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Jul 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,511
Mol. weight: 48 kDa
Released: 16 Jul 2014

Explore 4PB0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PB0 contains 14 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-40	7	2
β-strand	44-51	8	2
β-strand	57-59	3	2
α-helix	61-63	3
β-strand	67-72	6	1
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-94	7	2
β-strand	103	1	2
β-strand	107-111	5	2
α-helix	115-116	2
β-strand	117	1	3
α-helix	118-119	2
β-strand	120-124	5	4
β-strand	135-145	11	4
β-strand	146	1	3
β-strand	151-154	4	5
β-strand	159	1	5
β-strand	163-165	3	4
α-helix	166-168	3
β-strand	169-171	3	4
β-strand	174-184	11	4
β-strand	194-199	6	5
α-helix	200-202	3
β-strand	204-209	6	5

Chain L: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	2
β-strand	19-25	7	6
β-strand	30	1	7
β-strand	31	1	7
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	99	1	6
β-strand	102-107	6	2
β-strand	111	1	8
β-strand	114-118	5	9
α-helix	122-125	4
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	145-150	6	10
β-strand	153-154	2	10
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-186	4
β-strand	191-197	7	10
α-helix	204	1
β-strand	205-210	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ab53 heavy chain	H	protein	220	Mus musculus	Q6PIP8 (AlphaFold model)
Ab53 light chain	L	protein	216	Mus musculus

Sequence of entity 1 (H), FASTA

>4PB0_1 Ab53 heavy chain (chains H)
EVKLLESGGGLVQPGGSMKLSCVASGFTFSIFWMNWVRQSPEKGLEWVAEVRLKSNNYAT
HYAESVKGRFTISRDDSKSGVYLQMNNLRAEDTGIYYCTRGYYGSNYGEYWGQGTTLTVS
SAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP

Sequence of entity 2 (L), FASTA

>4PB0_2 Ab53 light chain (chains L)
DVVMTQSPSSLSVTIGQPASISCKSSQSLLDSDGGTYLNWLLQRPGQSPKRLIYLVSKLD
SGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGAHFPYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Primary citation

B-Cell Epitopes in GroEL of Francisella tularensis. Lu, Z., Rynkiewicz, M.J., Madico, G. et al. PLoS One (2014) 9:e99847-e99847. DOI 10.1371/journal.pone.0099847 · PubMed

Other PDB entries of the same protein (UniProt Q6PIP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R2H 2.0 Å, Structure of S25-2 in Complex with Ko
2AI0 2.2 Å, Anti-Cocaine Antibody 7.5.21, Crystal Form III

Browse structure collections

About this viewer

MolViewer shows 4PB0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.