Structure of the Fab fragment of the anti-Francisella tularensis GroEL antibody Ab53. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Jul 2014.
Explore 4PB0 in 3D Show helices and sheets RCSB PDB PDBe
4PB0 contains 14 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-40 | 7 | 2 |
| β-strand | 44-51 | 8 | 2 |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 2 |
| β-strand | 103 | 1 | 2 |
| β-strand | 107-111 | 5 | 2 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 3 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 4 |
| β-strand | 135-145 | 11 | 4 |
| β-strand | 146 | 1 | 3 |
| β-strand | 151-154 | 4 | 5 |
| β-strand | 159 | 1 | 5 |
| β-strand | 163-165 | 3 | 4 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-171 | 3 | 4 |
| β-strand | 174-184 | 11 | 4 |
| β-strand | 194-199 | 6 | 5 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-209 | 6 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 6 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 6 |
| β-strand | 30 | 1 | 7 |
| β-strand | 31 | 1 | 7 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 6 |
| β-strand | 70-75 | 6 | 6 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 99 | 1 | 6 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 111 | 1 | 8 |
| β-strand | 114-118 | 5 | 9 |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 9 |
| β-strand | 140 | 1 | 8 |
| β-strand | 145-150 | 6 | 10 |
| β-strand | 153-154 | 2 | 10 |
| β-strand | 159-163 | 5 | 9 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 9 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 10 |
| α-helix | 204 | 1 | |
| β-strand | 205-210 | 6 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ab53 heavy chain | H | protein | 220 | Mus musculus | Q6PIP8 (AlphaFold model) |
| Ab53 light chain | L | protein | 216 | Mus musculus |
>4PB0_1 Ab53 heavy chain (chains H) EVKLLESGGGLVQPGGSMKLSCVASGFTFSIFWMNWVRQSPEKGLEWVAEVRLKSNNYAT HYAESVKGRFTISRDDSKSGVYLQMNNLRAEDTGIYYCTRGYYGSNYGEYWGQGTTLTVS SAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQS DLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
>4PB0_2 Ab53 light chain (chains L) DVVMTQSPSSLSVTIGQPASISCKSSQSLLDSDGGTYLNWLLQRPGQSPKRLIYLVSKLD SGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGAHFPYTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
B-Cell Epitopes in GroEL of Francisella tularensis. Lu, Z., Rynkiewicz, M.J., Madico, G. et al. PLoS One (2014) 9:e99847-e99847. DOI 10.1371/journal.pone.0099847 · PubMed
Other PDB entries of the same protein (UniProt Q6PIP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PB0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.