4PXK: Bacteriorhodopsin

Crystal structure of Haloarcula marismortui bacteriorhodopsin I D94N mutant. Determined by X-ray diffraction at 2.5 Å resolution. Released 17 Dec 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Haloarcula marismortui
Chains: 1
Atoms: 2,044
Mol. weight: 33.88 kDa
Ligands: RET, LFA
Released: 17 Dec 2014

Explore 4PXK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PXK contains 11 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-29	22
α-helix	35-59	25
β-strand	64-69	6	1
β-strand	72-77	6	1
α-helix	79-98	20
α-helix	103-125	23
α-helix	134-158	25
α-helix	161-165	5
α-helix	169-195	27
α-helix	205-217	13
α-helix	218-222	5
α-helix	223-227	5
α-helix	231-235	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bacteriorhodopsin	A	protein	258	Haloarcula marismortui	Q5UXY6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4PXK_1 Bacteriorhodopsin (chains A)
MPAPGSEGIWLWLGTAGMFLGMLYFIARGWGETDGRRQKFYIATILITAIAFVNYLAMAL
GFGLTFIEFGGEQHPIYWARYTDWLFTTPLLLYNLGLLAGADRNTIYSLVSLDVLMIGTG
VVATLSAGSGVLSAGAERLVWWGISTAFLLVLLYFLFSSLSGRVANLPSDTRSTFKTLRN
LVTVVWLVYPVWWLVGSEGLGLVGIGIETAGFMVIDLVAKVGFGIILLRSHGVLDGAAET
TGTGATPADDLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
RET	Retinal	C20 H28 O	1
LFA	Eicosane	C20 H42	19

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal Structure of Escherichia coli-Expressed Haloarcula marismortui Bacteriorhodopsin I in the Trimeric Form. Shevchenko, V., Gushchin, I., Polovinkin, V. et al. PLoS One (2014) 9:e112873-e112873. DOI 10.1371/journal.pone.0112873 · PubMed

Other PDB entries of the same protein (UniProt Q5UXY6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DOH 1.45 Å, Crystal Structure of GD-26 Fab in Complex with TD Peptide from Haloarcula Marismortui…
8Y9Z 3.41 Å, Structure of the SecA-SecY complex with the substrate HmBRI-3TM

Browse structure collections

About this viewer

MolViewer shows 4PXK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.