4PXW: Human DCAF1 WD40 repeats

Crystal structure of human DCAF1 WD40 repeats (Q1250L). Determined by X-ray diffraction at 1.72 Å resolution. Released 16 Apr 2014.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,148
Mol. weight: 87.27 kDa
Released: 16 Apr 2014

Explore 4PXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PXW contains 4 α-helices and 62 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	1081-1087	7	1
β-strand	1096-1101	6	2
β-strand	1107-1112	6	2
β-strand	1116-1121	6	2
β-strand	1127-1132	6	2
β-strand	1140-1143	4	3
β-strand	1149-1153	5	3
β-strand	1161-1165	5	3
β-strand	1171-1176	6	3
β-strand	1181-1184	4	4
β-strand	1191-1196	6	4
β-strand	1199-1204	6	4
β-strand	1210-1214	5	4
β-strand	1225	1	5
β-strand	1229-1230	2	6
β-strand	1236-1239	4	6
β-strand	1242-1245	4	6
β-strand	1250-1254	5	6
α-helix	1255-1257	3
β-strand	1262	1	5
β-strand	1265-1266	2	7
β-strand	1272-1275	4	7
β-strand	1278-1281	4	7
β-strand	1287-1290	4	7
α-helix	1292-1294	3
β-strand	1297-1301	5	8
β-strand	1307-1313	7	8
β-strand	1330-1338	9	8
β-strand	1344-1349	6	8
β-strand	1353-1359	7	1
β-strand	1365-1371	7	1
β-strand	1382-1388	7	1

Chain B: 2 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	1081-1087	7	9
β-strand	1096-1101	6	10
β-strand	1107-1112	6	10
β-strand	1116-1121	6	10
β-strand	1127-1132	6	10
β-strand	1140-1143	4	11
β-strand	1149-1153	5	11
β-strand	1161-1165	5	11
β-strand	1171-1176	6	11
β-strand	1181-1184	4	12
β-strand	1191-1196	6	12
β-strand	1199-1204	6	12
β-strand	1210-1214	5	12
β-strand	1225	1	13
β-strand	1229-1230	2	14
β-strand	1236-1239	4	14
β-strand	1242-1245	4	14
β-strand	1250-1254	5	14
α-helix	1255-1257	3
β-strand	1262	1	13
β-strand	1265-1266	2	15
β-strand	1272-1275	4	15
β-strand	1278-1281	4	15
β-strand	1287-1290	4	15
α-helix	1292-1294	3
β-strand	1297-1301	5	16
β-strand	1307-1312	6	16
β-strand	1313	1	17
β-strand	1330	1	17
β-strand	1333-1338	6	16
β-strand	1344-1349	6	16
β-strand	1354-1359	6	9
β-strand	1365-1371	7	9
β-strand	1382-1388	7	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein VPRBP	A, B	protein	381	Homo sapiens	Q9Y4B6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PXW_1 Protein VPRBP (chains A, B)
MHHHHHHSSGRENLYFQGEPKQRRQAPINFTSRLNRRASFPKYGGVDGGCFDRHLIFSRF
RPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNVFSGQEEASYNCHNSAITH
LEPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYVEFSKHSQDRVIGTKGDIA
HIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSALAIHKFDKFNM
NISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDD
LMEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNM
DTVCRLYEVGRQRLAEDEDEE

Primary citation

Crystal structure of human DCAF1 WD40 repeats (Q1250L). Xu, C., Tempel, W., He, H. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y4B6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PLY 1.4 Å, Crystal structure of the human DCAF1 WDR domain in complex with OICR-40156
9BHS 1.43 Å, Crystal structure of the WDR domain of human DCAF1 in complex with OICR-9939 compound
9Y4Q 1.48 Å, Crystal structure of the human DCAF1 WDR domain in complex with OICR-40102
8OOD 1.5 Å, Crystal structure of human DCAF1 WD40 repeats (Q1250L) in complex with compound 15
9YDG 1.54 Å, Crystal structure of the human DCAF1 WDR domain in complex with OICR-41074
8F8E 1.55 Å, Crystal structure of the WDR domain of human DCAF1 in complex with OICR-8268 compound
9Y76 1.56 Å, Crystal structure of the human DCAF1 WDR domain in complex with OICR-40120
9YV4 1.6 Å, Crystal structure of the human DCAF1 WDR domain in complex with OICR-41109
7SSE 1.62 Å, Crystal structure of the WDR domain of human DCAF1 in complex with CYCA-117-70
9BHR 1.62 Å, Crystal structure of the WDR domain of human DCAF1 in complex with OICR-40155 compound
9D4E 1.7 Å, Crystal structure of the human DCAF1 WDR domain in complex with OICR-41103
9YE4 1.74 Å, Crystal structure of the human DCAF1 WDR domain in complex with OICR-41110

Browse structure collections

About this viewer

MolViewer shows 4PXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.