4PYP: Human glucose transporter GLUT1

Crystal structure of the human glucose transporter GLUT1. Determined by X-ray diffraction at 3.17 Å resolution. Released 21 May 2014.

Method: X-ray diffraction
Resolution: 3.17 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,490
Mol. weight: 56.04 kDa
Ligands: BNG
Released: 21 May 2014

Explore 4PYP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PYP contains 30 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 0 β-strands

Element	Residues	Length
α-helix	12-30	19
α-helix	37-52	16
α-helix	55-57	3
α-helix	58-90	33
α-helix	93-111	19
α-helix	113-116	4
α-helix	120-147	28
α-helix	153-173	21
α-helix	186-191	6
α-helix	194-203	10
α-helix	204-206	3
α-helix	208-210	3
α-helix	211-212	2
α-helix	213-217	5
α-helix	221-231	11
α-helix	238-253	16
α-helix	259-264	6
α-helix	266-269	4
α-helix	271-283	13
α-helix	287-292	6
α-helix	294-301	8
α-helix	306-330	25
α-helix	333-357	25
α-helix	364-381	18
α-helix	386-394	9
α-helix	400-421	22
α-helix	424-427	4
α-helix	430-432	3
α-helix	433-450	18
α-helix	452-454	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Solute carrier family 2, facilitated glucose transporter member 1	A	protein	504	Homo sapiens	P11166 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4PYP_1 Solute carrier family 2, facilitated glucose transporter member 1 (chains A)
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYTQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVQRAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQVLEHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
BNG	nonyl beta-D-glucopyranoside	C15 H30 O6	1

Primary citation

Crystal structure of the human glucose transporter GLUT1. Deng, D., Xu, C., Sun, P.C. et al. Nature (2014) 510:121-125. DOI 10.1038/nature13306 · PubMed

Other PDB entries of the same protein (UniProt P11166 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6THA 2.4 Å, Crystal structure of human sugar transporter GLUT1 (SLC2A1) in the inward conformation
5EQG 2.9 Å, Human GLUT1 in complex with inhibitor (2~{S})-3-(4-fluorophenyl)-2-[2-(3-hydroxyphenyl)et…
5EQH 2.99 Å, Human GLUT1 in complex with inhibitor (2~{S})-3-(2-bromophenyl)-2-[2-(4-methoxyphenyl)eth…
5EQI 3.0 Å, Human GLUT1 in complex with Cytochalasin B

Browse more

4PYP is part of these collections:

Membrane proteins and transporters

About this viewer

MolViewer shows 4PYP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.