Shigella Effector Kinase OspG bound to E2-Ub UbcH7-Ub Conjugate. Determined by X-ray diffraction at 1.87 Å resolution. Released 2 Jul 2014.
Explore 4Q5E in 3D Show helices and sheets RCSB PDB PDBe
4Q5E contains 18 α-helices and 26 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 29-35 | 7 | 1 |
| β-strand | 39-44 | 6 | 1 |
| β-strand | 47-55 | 9 | 1 |
| α-helix | 62-80 | 19 | |
| β-strand | 85-90 | 6 | 1 |
| β-strand | 93-99 | 7 | 1 |
| α-helix | 100-102 | 3 | |
| β-strand | 104-105 | 2 | 2 |
| α-helix | 106-108 | 3 | |
| α-helix | 111-113 | 3 | |
| α-helix | 118-131 | 14 | |
| β-strand | 136 | 1 | 3 |
| α-helix | 141-143 | 3 | |
| β-strand | 144-147 | 4 | 2 |
| β-strand | 152-155 | 4 | 2 |
| β-strand | 160 | 1 | 3 |
| α-helix | 162-167 | 6 | |
| α-helix | 170-191 | 22 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 4 |
| β-strand | 12-16 | 5 | 4 |
| β-strand | 22 | 1 | 5 |
| α-helix | 23-34 | 12 | |
| β-strand | 41-45 | 5 | 4 |
| β-strand | 48-49 | 2 | 4 |
| β-strand | 55 | 1 | 5 |
| α-helix | 57-59 | 3 | |
| α-helix | 61-62 | 2 | |
| β-strand | 66-71 | 6 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-17 | 17 | |
| β-strand | 22-27 | 6 | 6 |
| β-strand | 34-39 | 6 | 6 |
| β-strand | 50 | 1 | 7 |
| β-strand | 51-56 | 6 | 6 |
| β-strand | 67-70 | 4 | 6 |
| β-strand | 79 | 1 | 8 |
| β-strand | 84 | 1 | 6 |
| β-strand | 85 | 1 | 8 |
| α-helix | 88-90 | 3 | |
| α-helix | 101-113 | 13 | |
| α-helix | 123-131 | 9 | |
| α-helix | 133-147 | 15 | |
| α-helix | 148 | 1 | |
| β-strand | 149 | 1 | 7 |
| α-helix | 150-152 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein kinase OspG | A | protein | 174 | Shigella sonnei Ss046 | Q3YTH2 (AlphaFold model) |
| Polyubiquitin | B | protein | 76 | Saccharomyces cerevisiae | P0CG63 (AlphaFold model) |
| Ubiquitin-conjugating enzyme E2 L3 | C | protein | 156 | Homo sapiens | P68036 (AlphaFold model) |
>4Q5E_1 Protein kinase OspG (chains A) SNAEPILGKLIGQGSTAEIFEDVNDSSALYKKYDLIGNQYNEILEMAWQESELFNAFYGD EASVVIQYGGDVYLRMLRVPGTPLSDIDTADIPDNIESLYLQLICKLNELSIIHYDLNTG NMLYDKESESLFPIDFRNIYAEYYAATKKDKEIIDRRLQMRTNDFYSLLNRKYL
>4Q5E_2 Polyubiquitin (chains B) MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYN IQKESTLHLVLRLRGC
>4Q5E_3 Ubiquitin-conjugating enzyme E2 L3 (chains C) GHMAASRRLMKELEEIRKSGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFP AEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPE HPLRADLAEEYSKDRKKFSKNAEEFTKKYGEKRPVD
Structural Basis for the Inhibition of Host Protein Ubiquitination by Shigella Effector Kinase OspG. Grishin, A.M., Condos, T.E., Barber, K.R. et al. Structure (2014) 22:878-888. DOI 10.1016/j.str.2014.04.010 · PubMed
Other PDB entries of the same protein (UniProt Q3YTH2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Q5E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.