4QAM: RPGR RCC1-like domain

Crystal Structure of the RPGR RCC1-like domain in complex with the RPGR-interacting domain of RPGRIP1. Determined by X-ray diffraction at 1.83 Å resolution. Released 30 Jul 2014.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,654
Mol. weight: 67.43 kDa
Ligands: MG
Released: 30 Jul 2014

Explore 4QAM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QAM contains 17 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	13-18	6	1
α-helix	23-25	3
β-strand	28-30	3	1
β-strand	31-32	2	2
β-strand	37-42	6	3
β-strand	46-51	6	3
β-strand	56-60	5	3
β-strand	69	1	4
β-strand	75-80	6	3
α-helix	82-84	3
β-strand	89-94	6	5
β-strand	98-103	6	5
β-strand	108-112	5	5
β-strand	127-132	6	5
β-strand	142-147	6	6
β-strand	151-156	6	6
β-strand	161-166	6	6
β-strand	179-185	7	6
β-strand	192-197	6	7
β-strand	201-206	6	7
β-strand	211-215	5	7
α-helix	226-231	6
β-strand	236-237	2	7
α-helix	244	1
β-strand	245-250	6	8
β-strand	254-259	6	8
β-strand	263-268	6	8
β-strand	282-288	7	8
α-helix	290-292	3
β-strand	297-302	6	9
β-strand	306-311	6	9
β-strand	316-320	5	9
α-helix	323-325	3
β-strand	337-342	6	9
α-helix	344-346	3
β-strand	349-356	8	1
β-strand	360-367	8	1

Chain B: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	1100	1
β-strand	1101-1102	2	2
β-strand	1117-1127	11	10
α-helix	1132-1135	4
β-strand	1141-1145	5	10
α-helix	1153-1156	4
β-strand	1157	1	10
β-strand	1162-1163	2	10
α-helix	1164-1165	2
β-strand	1171-1180	10	10
α-helix	1187-1197	11
β-strand	1206-1213	8	10
α-helix	1220-1222	3
β-strand	1224-1232	9	10
α-helix	1233-1239	7
α-helix	1242-1243	2
β-strand	1246-1251	6	10
β-strand	1259-1268	10	10
α-helix	1270-1282	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
X-linked retinitis pigmentosa GTPase regulator	A	protein	400	Homo sapiens	Q92834 (AlphaFold model)
X-linked retinitis pigmentosa GTPase regulator-interacting protein 1	B	protein	201	Homo sapiens	Q96KN7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4QAM_1 X-linked retinitis pigmentosa GTPase regulator (chains A)
MREPEELMPDSGAVFTFGKSKFAENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFG
SNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLG
LGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNV
CVPQQVTIGKPVSWVSCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSE
IPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYI
SCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCH
MVVFAAPHRGVAKEIEFDEINDTCLSVATFLPWSHPQFEK

Sequence of entity 2 (B), FASTA

>4QAM_2 X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 (chains B)
GAMGSSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSLAFYPEAEVMSDENIKQVYVE
YKFYDLPLSETETPVSLRKPRAGEEIHFHFSKVIDLDPQEQQGRRRFLFDMLNGQDPDQG
HLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKV
SLQAAAVLHAIYKEMTEDLFS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

C2 domains as protein-protein interaction modules in the ciliary transition zone. Remans, K., Burger, M., Vetter, I.R. et al. Cell Rep (2014) 8:1-9. DOI 10.1016/j.celrep.2014.05.049 · PubMed

Other PDB entries of the same protein (UniProt Q92834 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JHN 1.7 Å, The crystal structure of the RPGR RCC1-like domain
4JHP 1.9 Å, The crystal structure of the RPGR RCC1-like domain in complex with PDE6D

Browse structure collections

About this viewer

MolViewer shows 4QAM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.