4QC3: Human BAZ2B bromodomain

Crystal structure of human BAZ2B bromodomain in complex with a diacetylated histone 4 peptide (H4K8acK12ac). Determined by X-ray diffraction at 1.6 Å resolution. Released 21 May 2014.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,098
Mol. weight: 25.86 kDa
Released: 21 May 2014

Explore 4QC3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QC3 contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	2063-2077	15
α-helix	2083-2085	3
α-helix	2097-2100	4
α-helix	2107-2115	9
α-helix	2122-2139	18
α-helix	2145-2165	21

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	2063-2077	15
α-helix	2083-2085	3
α-helix	2088-2090	3
α-helix	2097-2100	4
α-helix	2107-2115	9
α-helix	2122-2139	18
α-helix	2145-2165	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain adjacent to zinc finger domain protein 2B	A, B	protein	107	Homo sapiens	Q9UIF8 (AlphaFold model)
diacetylated histone 4 peptide (H4K8acK12ac)	C	protein	7

Sequence of entity 1 (A, B), FASTA

>4QC3_1 Bromodomain adjacent to zinc finger domain protein 2B (chains A, B)
SMDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQY
PNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFK

Sequence of entity 2 (C), FASTA

>4QC3_2 diacetylated histone 4 peptide (H4K8acK12ac) (chains C)
GKGLGKG

Primary citation

Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC. Tallant, C., Valentini, E., Fedorov, O. et al. Structure (2015) 23:80-92. DOI 10.1016/j.str.2014.10.017 · PubMed

Other PDB entries of the same protein (UniProt Q9UIF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5PG1 1.49 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PFM 1.54 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PGB 1.57 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PGJ 1.58 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PGA 1.59 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
4QF3 1.6 Å, Crystal structure of human BAZ2B PHD zinc finger in the free form
5PGC 1.61 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PG9 1.62 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PDG 1.63 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PFW 1.64 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PGS 1.64 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B after initial refinement…
5PB8 1.65 Å, PanDDA analysis group deposition -- Crystal Structure of BAZ2B in complex with N09522a

Browse structure collections

About this viewer

MolViewer shows 4QC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.