4QDL: E.coli Cas1-Cas2 complex

Crystal structure of E.coli Cas1-Cas2 complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 May 2014.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Escherichia coli
Chains: 6
Atoms: 9,133
Mol. weight: 156.43 kDa
Released: 28 May 2014

Explore 4QDL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QDL contains 60 α-helices and 46 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	17-20	4	1
β-strand	23-28	6	2
β-strand	31-35	5	2
β-strand	41-43	3	2
β-strand	51-54	4	1
α-helix	55	1
β-strand	58-61	4	2
α-helix	62-71	10
β-strand	74-78	5	1
α-helix	80-82	3
β-strand	85-89	5	1
α-helix	96-107	12
α-helix	109-124	16
α-helix	134-156	23
α-helix	175-198	24
α-helix	214-223	10
α-helix	228-236	9
α-helix	243-257	15
α-helix	260-273	14
α-helix	278-279	2

Chain B: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	11-13	3
β-strand	15-20	6	1
β-strand	23-28	6	2
β-strand	31-35	5	2
β-strand	41-43	3	2
α-helix	46-48	3
β-strand	49-54	6	1
β-strand	58-61	4	2
α-helix	62-71	10
β-strand	74-78	5	1
α-helix	80-82	3
β-strand	84-89	6	1
α-helix	96-107	12
α-helix	109-124	16
α-helix	127-129	3
α-helix	134-156	23
α-helix	175-198	24
α-helix	214-223	10
α-helix	228-238	11
α-helix	243-258	16
α-helix	260-273	14
α-helix	278-282	5

Chain C: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	16-20	5	3
β-strand	23-28	6	4
β-strand	31-35	5	4
β-strand	41-43	3	4
β-strand	49-54	6	3
α-helix	55	1
β-strand	58-61	4	4
α-helix	62-71	10
β-strand	74-78	5	3
α-helix	80-82	3
β-strand	85-89	5	3
α-helix	96-107	12
α-helix	109-123	15
α-helix	136-155	20
α-helix	176-198	23
α-helix	214-223	10
α-helix	224-228	5
α-helix	229-235	7
α-helix	246-258	13
α-helix	260-273	14
α-helix	277-279	3

Chain D: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	11-13	3
β-strand	15-20	6	3
β-strand	23-28	6	4
β-strand	31-35	5	4
β-strand	41-43	3	4
α-helix	46-48	3
β-strand	49-54	6	3
β-strand	58-61	4	4
α-helix	62-70	9
β-strand	74-78	5	3
α-helix	80-82	3
β-strand	84-89	6	3
α-helix	96-107	12
α-helix	109-124	16
α-helix	127-129	3
α-helix	134-156	23
α-helix	175-198	24
α-helix	214-223	10
α-helix	228-238	11
α-helix	243-257	15
α-helix	260-273	14
α-helix	278-281	4

Chain E: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	5
α-helix	13-22	10
β-strand	24-27	4	5
β-strand	30-34	5	5
α-helix	37-50	14
β-strand	55-61	7	5
β-strand	68-73	6	5
β-strand	79-83	5	4
β-strand	86-91	6	4

Chain F: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	6
α-helix	13-22	10
β-strand	24-27	4	6
β-strand	30-34	5	6
α-helix	37-50	14
β-strand	55-61	7	6
β-strand	68-74	7	6
β-strand	79-83	5	2
β-strand	86-91	6	2
α-helix	92-94	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRISPR-associated endonuclease Cas1	A, B, C, D	protein	305	Escherichia coli	Q46896 (AlphaFold model)
CRISPR-associated endoribonuclease Cas2	E, F	protein	104	Escherichia coli	P45956 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4QDL_1 CRISPR-associated endonuclease Cas1 (chains A, B, C, D)
MTWLPLNPIPLKDRVSMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRV
SHAAVRLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLKVVRKMF
ELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRYDPKDWEKGDTINQCI
SAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVYDIADIIKFDTVVPKAFEIARRNP
GEPDREVRLACRDIFRSSKTLAKLIPLIEDVLAAGEIQPPAPPEDAQPVAIPLPVSLGDA
GHRSS

Sequence of entity 2 (E, F), FASTA

>4QDL_2 CRISPR-associated endoribonuclease Cas2 (chains E, F)
MSMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLAEEGNVVMAW
ATNTETGFEFQTFGLNRRTPVDLDGLRLVSFLPVLESGHHHHHH

Primary citation

Crystal structure of E.coli Cas1-Cas2 complex. Tamulaitiene, G., Sinkunas, T., Silanskas, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q46896 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NKE 1.4 Å, High resolution structure of the C-terminal domain CRISP-associated protein Cas1 from…
3NKD 1.95 Å, Structure of CRISP-associated protein Cas1 from Escherichia coli str. K-12
4P6I 2.3 Å, Crystal structure of the Cas1-Cas2 complex from Escherichia coli
5DLJ 2.6 Å, Crystal Structure of Cas-DNA-N1 complex
5DQZ 2.7 Å, Crystal Structure of Cas-DNA-PAM complex
5VVK 2.9 Å, Cas1-Cas2 bound to full-site mimic
5DS5 2.95 Å, Crystal structure the Escherichia coli Cas1-Cas2 complex bound to protospacer DNA and Mg
5DQT 3.1 Å, Crystal Structure of Cas-DNA-22 complex
5DS4 3.2 Å, Crystal structure the Escherichia coli Cas1-Cas2 complex bound to protospacer DNA
5VVL 3.31 Å, Cas1-Cas2 bound to full-site mimic with Ni
5DS6 3.35 Å, Crystal structure the Escherichia coli Cas1-Cas2 complex bound to protospacer DNA with…
5WFE 3.64 Å, Cas1-Cas2-IHF-DNA holo-complex

Browse structure collections

About this viewer

MolViewer shows 4QDL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.