4QDS: Physical basis for Nrp2 ligand binding

Physical basis for Nrp2 ligand binding. Determined by X-ray diffraction at 2.4 Å resolution. Released 15 Apr 2015.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,958
Mol. weight: 42.02 kDa
Released: 15 Apr 2015

Explore 4QDS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QDS contains 9 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	279-280	2	1
α-helix	290-292	3
β-strand	293-295	3	1
α-helix	306-308	3
β-strand	310	1	1
β-strand	318	1	2
β-strand	329-345	17	1
β-strand	347-348	2	3
β-strand	355-356	2	3
β-strand	357-366	10	1
β-strand	373-374	2	1
β-strand	376-377	2	4
β-strand	380-381	2	4
α-helix	382	1
β-strand	384-385	2	1
β-strand	394-415	22	1
β-strand	420	1	2
β-strand	421-428	8	1
α-helix	429-431	3
α-helix	434-451	18

Chain B: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	279-280	2	5
α-helix	290-292	3
β-strand	293-295	3	5
α-helix	306-308	3
β-strand	310	1	5
β-strand	318	1	6
β-strand	329-345	17	5
β-strand	347-348	2	7
β-strand	355-356	2	7
β-strand	357-366	10	5
β-strand	373-374	2	5
β-strand	376-377	2	8
β-strand	380-381	2	8
β-strand	384-385	2	5
β-strand	394-415	22	5
β-strand	420	1	6
β-strand	421-428	8	5
α-helix	429-431	3
α-helix	434-451	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuropilin-2	A, B	protein	187	Homo sapiens	O60462 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4QDS_1 Neuropilin-2 (chains A, B)
GSHMFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQ
VDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDA
TEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQI
SASSTQE

Primary citation

Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form. Parker, M.W., Linkugel, A.D., Goel, H.L. et al. Structure (2015) 23:677-687. DOI 10.1016/j.str.2015.01.018 · PubMed

Other PDB entries of the same protein (UniProt O60462 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TJT 1.31 Å, Neuropilin2-b1 domain in a complex with the C-terminal VEGFC peptide
5DQ0 1.8 Å, Structure of human neuropilin-2 b1 domain with novel and unique zinc binding site
8IVX 1.9 Å, Crystal structure of NRP2 in complex with aNRP2-14 Fab fragment
2QQJ 1.95 Å, Crystal Structure of the b1b2 Domains from Human Neuropilin-2
4QDQ 1.95 Å, Physical basis for Nrp2 ligand binding
5DN2 1.95 Å, Human NRP2 b1 domain in complex with the peptide corresponding to the C-terminus of VEGF-A
2QQO 2.3 Å, Crystal Structure of the a2b1b2 Domains from Human Neuropilin-2
4QDR 2.4 Å, Physical basis for Nrp2 ligand binding
6GH8 2.44 Å, Crystal structure of GP1 domain of Lujo virus in complex with the first CUB domain of…
6TDB 2.45 Å, Neuropilin2-b1 domain in a complex with the C-terminal VEGFB167 peptide
2QQK 2.75 Å, Neuropilin-2 a1a2b1b2 Domains in Complex with a Semaphorin-Blocking Fab
2QQL 3.1 Å, Neuropilin-2 a1a2b1b2 Domains in Complex with a Semaphorin-Blocking Fab

Browse structure collections

About this viewer

MolViewer shows 4QDS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.