Crystal structure of human BAZ2B PHD zinc finger in the free form. Determined by X-ray diffraction at 1.6 Å resolution. Released 2 Jul 2014.
Explore 4QF3 in 3D Show helices and sheets RCSB PDB PDBe
4QF3 contains 6 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1934 | 1 | 1 |
| α-helix | 1943-1945 | 3 | |
| β-strand | 1946-1948 | 3 | 1 |
| β-strand | 1949 | 1 | 2 |
| β-strand | 1955-1957 | 3 | 1 |
| β-strand | 1962 | 1 | 3 |
| α-helix | 1964-1965 | 2 | |
| β-strand | 1973 | 1 | 2 |
| α-helix | 1976-1982 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bromodomain adjacent to zinc finger domain protein 2B | A, B | protein | 58 | Homo sapiens | Q9UIF8 (AlphaFold model) |
>4QF3_1 Bromodomain adjacent to zinc finger domain protein 2B (chains A, B) HMSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKAS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Molecular basis of histone tail recognition by human TIP5 PHD finger and bromodomain of the chromatin remodeling complex NoRC. Tallant, C., Valentini, E., Fedorov, O. et al. Structure (2015) 23:80-92. DOI 10.1016/j.str.2014.10.017 · PubMed
Other PDB entries of the same protein (UniProt Q9UIF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4QF3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.