4QFT: COP9 signalosome complex subunit 6

Structure of COP9 signalosome complex subunit 6. Determined by X-ray diffraction at 1.76 Å resolution. Released 3 Sept 2014.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,649
Mol. weight: 20.78 kDa
Released: 3 Sept 2014

Explore 4QFT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QFT contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	40-43	4	1
α-helix	45-62	18
β-strand	69-77	9	1
β-strand	80-88	9	1
β-strand	91-94	4	2
β-strand	97-100	4	2
α-helix	102-115	14
β-strand	120-127	8	1
α-helix	133-142	10
β-strand	150-154	5	1
β-strand	165-174	10	1
β-strand	179-186	8	1
β-strand	189-190	2	1
α-helix	191-192	2
α-helix	200-207	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
COP9 signalosome complex subunit 6	A	protein	186	Homo sapiens	Q7L5N1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4QFT_1 COP9 signalosome complex subunit 6 (chains A)
GPLGSMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMN
SFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEI
IESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVAR
MTATGS

Primary citation

Structural and biochemical characterization of the Cop9 signalosome CSN5/CSN6 heterodimer. Birol, M., Enchev, R.I., Padilla, A. et al. PLoS One (2014) 9:e105688-e105688. DOI 10.1371/journal.pone.0105688 · PubMed

Other PDB entries of the same protein (UniProt Q7L5N1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R14 2.6 Å, Crystal structure of human CSN6 MPN domain
9QO4 2.95 Å, Dissociation-state-3 of 9-subunit CSN and SCF (SKP1-SKP2-CKS1) complex
9EFQ 2.96 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-2
9PH4 3.0 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-1a
9QO6 3.0 Å, 9-subunit COP9 signalosome complex
9EFV 3.03 Å, Cryo-EM structure of CSN-N8CUL1 in complex with CSN5i-3
9EFM 3.16 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-1
9QO1 3.23 Å, Activated 9-subunit COP9 signalosome and neddylated SCF (SKP1-SKP2-CKS1) complex structure
9QO0 3.26 Å, Pre-activated 9-subunit COP9 signalosome and neddylated SCF (Skp1-Skp2-Cks1) complex…
9E77 3.3 Å, Cryo-EM structure of CSN-N8 in complex with CSN5i-3
9E81 3.3 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-3
9EG8 3.39 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-4A

Browse structure collections

About this viewer

MolViewer shows 4QFT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.