4QQ4: CW-type zinc finger of MORC3

CW-type zinc finger of MORC3 in complex with the amino terminus of histone H3. Determined by X-ray diffraction at 1.75 Å resolution. Released 20 Aug 2014.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,045
Mol. weight: 18.24 kDa
Ligands: ZN
Released: 20 Aug 2014

Explore 4QQ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QQ4 contains 8 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	407	1
β-strand	408-412	5	1
β-strand	419-422	4	1
α-helix	426-430	5
α-helix	435-437	3
α-helix	441-443	3
α-helix	449-452	4

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	407	1
β-strand	408-412	5	2
β-strand	419-422	4	2
α-helix	435-437	3
α-helix	449-452	4

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-6	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MORC family CW-type zinc finger protein 3	A, B	protein	62	Homo sapiens	Q14149 (AlphaFold model)
Histone H3.3	C, D	protein	16	Homo sapiens	P84243 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4QQ4_1 MORC family CW-type zinc finger protein 3 (chains A, B)
GEDIQKRPDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLV
HP

Sequence of entity 2 (C, D), FASTA

>4QQ4_2 Histone H3.3 (chains C, D)
ARTKQTARKSTGGKAX

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Water and common crystallization additives (CL, UNX) are not listed.

Primary citation

Family-wide Characterization of Histone Binding Abilities of Human CW Domain-containing Proteins. Liu, Y., Tempel, W., Zhang, Q. et al. J Biol Chem (2016) 291:9000-9013. DOI 10.1074/jbc.M116.718973 · PubMed

Other PDB entries of the same protein (UniProt Q14149 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5SVY 1.05 Å, MORC3 CW in complex with histone H3K4me1
6O5W 1.41 Å, Crystal structure of MORC3 CW domain fused with viral influenza A NS1 peptide
5SVX 1.56 Å, MORC3 CW in complex with histone H3K4me3
5SVI 1.61 Å, MORC3 CW domain in complex with unmodified histone H3
6O1E 2.41 Å, The crystal structure of human MORC3 ATPase-CW in complex with AMPPNP

Browse structure collections

About this viewer

MolViewer shows 4QQ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.