4R14: Human CSN6 MPN domain

Crystal structure of human CSN6 MPN domain. Determined by X-ray diffraction at 2.6 Å resolution. Released 22 Oct 2014.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,498
Mol. weight: 43.07 kDa
Ligands: HG
Released: 22 Oct 2014

Explore 4R14 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4R14 contains 8 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	40-43	4	1
α-helix	45-62	18
β-strand	69-77	9	1
β-strand	80-88	9	1
β-strand	91-93	3	2
β-strand	98-100	3	2
α-helix	102-112	11
β-strand	120-127	8	1
α-helix	133-142	10
β-strand	150-154	5	1
α-helix	160-162	3
β-strand	167-174	8	3
β-strand	179-186	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
COP9 signalosome complex subunit 6	A, B	protein	181	Homo sapiens	Q7L5N1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4R14_1 COP9 signalosome complex subunit 6 (chains A, B)
SVSVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEK
IIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPM
TKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGLEHHHHH
H

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	8

Primary citation

Crystal structure of the human CSN6 MPN domain. Ma, X.L., Xu, M., Jiang, T. Biochem Biophys Res Commun (2014) 453:25-30. DOI 10.1016/j.bbrc.2014.09.046 · PubMed

Other PDB entries of the same protein (UniProt Q7L5N1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QFT 1.76 Å, Structure of COP9 signalosome complex subunit 6
9QO4 2.95 Å, Dissociation-state-3 of 9-subunit CSN and SCF (SKP1-SKP2-CKS1) complex
9EFQ 2.96 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-2
9PH4 3.0 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-1a
9QO6 3.0 Å, 9-subunit COP9 signalosome complex
9EFV 3.03 Å, Cryo-EM structure of CSN-N8CUL1 in complex with CSN5i-3
9EFM 3.16 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-1
9QO1 3.23 Å, Activated 9-subunit COP9 signalosome and neddylated SCF (SKP1-SKP2-CKS1) complex structure
9QO0 3.26 Å, Pre-activated 9-subunit COP9 signalosome and neddylated SCF (Skp1-Skp2-Cks1) complex…
9E77 3.3 Å, Cryo-EM structure of CSN-N8 in complex with CSN5i-3
9E81 3.3 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-3
9EG8 3.39 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-4A

Browse structure collections

About this viewer

MolViewer shows 4R14 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.