Wilms Tumor Protein (WT1) zinc fingers in complex with formylated DNA. Determined by X-ray diffraction at 1.54 Å resolution. Released 8 Oct 2014.
Explore 4R2Q in 3D Show helices and sheets RCSB PDB PDBe
4R2Q contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 353-354 | 2 | 1 |
| β-strand | 363-364 | 2 | 1 |
| α-helix | 367-378 | 12 | |
| β-strand | 383-384 | 2 | 2 |
| β-strand | 391-392 | 2 | 2 |
| α-helix | 395-406 | 12 | |
| β-strand | 411-412 | 2 | 3 |
| β-strand | 421-422 | 2 | 3 |
| α-helix | 425-435 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Wilms tumor protein, isoform 4/CRA_a | A | protein | 93 | Homo sapiens | P19544 (AlphaFold model) |
| DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*(5FC)P*GP*T)-3') | B | DNA | 11 | synthetic construct | |
| DNA (5'-D(*TP*AP*(5FC)P*GP*CP*CP*CP*AP*CP*GP*C)-3') | C | DNA | 11 | synthetic construct |
>4R2Q_1 Wilms tumor protein, isoform 4/CRA_a (chains A) GPLGSEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRT HTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
>4R2Q_2 DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*(5FC)P*GP*T)-3') (chains B) AGCGTGGGCGT
>4R2Q_3 DNA (5'-D(*TP*AP*(5FC)P*GP*CP*CP*CP*AP*CP*GP*C)-3') (chains C) TACGCCCACGC
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (EDO) are not listed.
Wilms tumor protein recognizes 5-carboxylcytosine within a specific DNA sequence. Hashimoto, H., Olanrewaju, Y.O., Zheng, Y. et al. Genes Dev (2014) 28:2304-2313. DOI 10.1101/gad.250746.114 · PubMed
Other PDB entries of the same protein (UniProt P19544 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4R2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.