4R3O: Human Constitutive 20S Proteasome

Human Constitutive 20S Proteasome. Determined by X-ray diffraction at 2.6 Å resolution. Released 28 Jan 2015.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 28
Atoms: 47,831
Mol. weight: 697.9 kDa
Released: 28 Jan 2015

Explore 4R3O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4R3O contains 226 α-helices and 391 β-strands across 28 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains 1 and M: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	11-16	6	7
β-strand	21-26	6	7
β-strand	29-31	3	8
β-strand	34-37	4	8
β-strand	43-45	3	9
β-strand	50-56	7	9
α-helix	58-79	22
α-helix	82-84	3
α-helix	85-97	13
β-strand	106-113	8	9
β-strand	119-124	6	9
β-strand	130-133	4	9
β-strand	135-139	5	7
α-helix	142-152	11
α-helix	164-167	4
α-helix	168-185	18
β-strand	186	1	37
β-strand	192-199	8	7
β-strand	202-209	8	7

Chains 2 and N: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	15
β-strand	12-16	5	16
β-strand	19-25	7	16
β-strand	28-30	3	15
β-strand	33-36	4	15
β-strand	42-45	4	15
β-strand	49-56	8	15
α-helix	57-77	21
α-helix	85-101	17
β-strand	108-116	9	15
β-strand	119-125	7	15
β-strand	131-133	3	15
β-strand	136-138	3	16
α-helix	140-143	4
α-helix	146-154	9
α-helix	162-179	18
β-strand	180	1	33
β-strand	187-193	7	16
β-strand	196-203	8	16
α-helix	210-213	4

Chain A: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	23-33	11
β-strand	38-43	6	1
β-strand	47-53	7	1
β-strand	61	1	2
α-helix	63-65	3
β-strand	69-73	5	3
β-strand	76-82	7	3
α-helix	84-105	22
α-helix	108-110	3
α-helix	111-127	17
β-strand	128	1	4
β-strand	131	1	5
α-helix	132-134	3
β-strand	136-143	8	3
β-strand	149-154	6	3
β-strand	160-162	3	3
β-strand	163	1	6
β-strand	165-169	5	1
α-helix	173-183	11
α-helix	191-206	16
β-strand	215-221	7	1
β-strand	228-229	2	1
α-helix	232-240	9

Chains B and P: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	10
β-strand	12	1	11
β-strand	18	1	11
α-helix	19-28	10
α-helix	32-33	2
β-strand	34-38	5	12
β-strand	43-48	6	12
β-strand	56	1	6
β-strand	65-66	2	13
β-strand	71-77	7	13
α-helix	79-100	22
α-helix	103-105	3
α-helix	106-119	14
β-strand	124	1	10
β-strand	126	1	4
α-helix	127-129	3
β-strand	131-138	8	13
β-strand	143-148	6	13
β-strand	154-156	3	13
β-strand	157	1	14
β-strand	159-162	4	12
α-helix	166-175	10
α-helix	183-194	12
β-strand	207-213	7	12
β-strand	216-219	4	12
α-helix	220-221	2
α-helix	222-228	7

Chains C and Q: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	19-29	11
α-helix	32-33	2
β-strand	34-38	5	17
β-strand	43-48	6	17
β-strand	56	1	14
β-strand	65-69	5	18
β-strand	72-78	7	18
α-helix	80-101	22
α-helix	104-106	3
α-helix	107-123	17
α-helix	127-129	3
β-strand	132-140	9	18
β-strand	144-150	7	18
β-strand	156-159	4	18
β-strand	161-164	4	17
α-helix	168-178	11
α-helix	186-200	15
β-strand	211-219	9	17
β-strand	222-227	6	17
α-helix	228-229	2
α-helix	230-244	15

Chain D: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	10	1	19
β-strand	16	1	19
α-helix	17-27	11
α-helix	30-31	2
β-strand	32-36	5	20
β-strand	41-45	5	20
β-strand	54	1	18
α-helix	56-59	4
β-strand	62-64	3	21
β-strand	69-75	7	21
α-helix	77-97	21
α-helix	104-118	15
β-strand	121	1	22
β-strand	129-136	8	21
β-strand	142-147	6	21
β-strand	153-156	4	21
β-strand	158-161	4	20
α-helix	165-175	11
α-helix	184-195	12
β-strand	207-211	5	20
α-helix	216-217	2
β-strand	218-219	2	20
α-helix	220-221	2
α-helix	222-235	14

Chain E: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	23
α-helix	16	1
β-strand	21	1	23
α-helix	22-31	10
α-helix	35-36	2
β-strand	37-42	6	24
β-strand	45-51	7	24
β-strand	59-60	2	21
α-helix	61-63	3
β-strand	67-71	5	25
β-strand	74-80	7	25
α-helix	82-103	22
α-helix	106-108	3
α-helix	109-117	9
β-strand	123	1	22
β-strand	133	1	22
β-strand	139-147	9	25
β-strand	150-156	7	25
β-strand	162-164	3	25
β-strand	165	1	26
β-strand	167-170	4	24
α-helix	174-184	11
α-helix	191-205	15
α-helix	209-210	2
β-strand	215-221	7	24
β-strand	224-228	5	24
α-helix	231-238	8

Chains F and T: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	20-30	11
α-helix	33-34	2
β-strand	35-39	5	27
β-strand	43-49	7	27
β-strand	57	1	26
α-helix	58-61	4
β-strand	63-67	5	28
β-strand	70-76	7	28
α-helix	78-99	22
α-helix	102-104	3
α-helix	105-117	13
α-helix	118-120	3
β-strand	122	1	29
β-strand	130-138	9	28
β-strand	141-147	7	28
β-strand	153-156	4	28
β-strand	158-161	4	27
α-helix	165-174	10
α-helix	176-179	4
α-helix	184-196	13
β-strand	210-216	7	27
β-strand	219-224	6	27
α-helix	230-233	4

14 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteasome subunit alpha type-6	A, O	protein	244	Homo sapiens	P60900 (AlphaFold model)
Proteasome subunit alpha type-2	B, P	protein	233	Homo sapiens	P25787 (AlphaFold model)
Proteasome subunit alpha type-4	C, Q	protein	250	Homo sapiens	P25789 (AlphaFold model)
Proteasome subunit alpha type-7	D, R	protein	243	Homo sapiens	O14818 (AlphaFold model)
Proteasome subunit alpha type-5	E, S	protein	234	Homo sapiens	P28066
Proteasome subunit alpha type-1	F, T	protein	238	Homo sapiens	P25786
Proteasome subunit alpha type-3	G, U	protein	245	Homo sapiens	P25788
Proteasome subunit beta type-6	H, V	protein	202	Homo sapiens	P28072
Proteasome subunit beta type-7	I, W	protein	220	Homo sapiens	Q99436
Proteasome subunit beta type-3	J, X	protein	204	Homo sapiens	P49720
Proteasome subunit beta type-2	K, Y	protein	199	Homo sapiens	P49721
Proteasome subunit beta type-5	L, Z	protein	201	Homo sapiens	P28074

2 more molecules are not listed.

Sequence of entity 1 (A, O), FASTA

>4R3O_1 Proteasome subunit alpha type-6 (chains A, O)
SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLL
DSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADI
SQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEK
KVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVA
LAER

Sequence of entity 2 (B, P), FASTA

>4R3O_2 Proteasome subunit alpha type-2 (chains B, P)
AERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERS
VHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEY
TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNED
LELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

Sequence of entity 3 (C, Q), FASTA

>4R3O_3 Proteasome subunit alpha type-4 (chains C, Q)
SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFF
SEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAY
TQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKE
GEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHE
EEEAKAEREK

Sequence of entity 4 (D, R), FASTA

>4R3O_4 Proteasome subunit alpha type-7 (chains D, R)
SYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRK
ICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQS
NGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAI
ETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEK
KKQ

Sequence of entity 5 (E, S), FASTA

>4R3O_5 Proteasome subunit alpha type-5 (chains E, S)
YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKI
VEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEED
ADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHK
SMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Sequence of entity 6 (F, T), FASTA

>4R3O_6 Proteasome subunit alpha type-1 (chains F, T)
NQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKI
LHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRY
GRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECN
LNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQ

Sequence of entity 7 (G, U), FASTA

>4R3O_7 Proteasome subunit alpha type-3 (chains G, U)
SSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEE
GSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVH
AYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQ
MKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAK
ESLKE

Sequence of entity 8 (H, V), FASTA

>4R3O_8 Proteasome subunit beta type-6 (chains H, V)
TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVT
YQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMM
VRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIA
ESGVERQVLLGDQIPKFAVATL

Sequence of entity 9 (I, W), FASTA

>4R3O_9 Proteasome subunit beta type-7 (chains I, W)
TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLIS
SNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTD
KLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISK
NKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLE

Sequence of entity 10 (J, X), FASTA

>4R3O_10 Proteasome subunit beta type-3 (chains J, X)
SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQ
TVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFI
CSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVS
GMGVIVHIIEKDKITTRTLKARMD

Sequence of entity 11 (K, Y), FASTA

>4R3O_11 Proteasome subunit beta type-2 (chains K, Y)
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQ

Sequence of entity 12 (L, Z), FASTA

>4R3O_12 Proteasome subunit beta type-5 (chains L, Z)
TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLA
RQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNR
ISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVR
EDGWIRVSSDNVADLHEKYSG

Primary citation

Crystal Structure of the Human 20S Proteasome in Complex with Carfilzomib. Harshbarger, W., Miller, C., Diedrich, C. et al. Structure (2015) 23:418-424. DOI 10.1016/j.str.2014.11.017 · PubMed

Other PDB entries of the same protein (UniProt P60900 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LE5 1.8 Å, Native human 20S proteasome at 1.8 Angstrom
9TMN 1.85 Å, Human sperm 20S proteasome complex isolated from native source
5LEY 1.9 Å, Human 20S proteasome complex with Oprozomib at 1.9 Angstrom
5LF4 1.99 Å, Human 20S proteasome complex with Delanzomib at 2.0 Angstrom
5LF1 2.0 Å, Human 20S proteasome complex with Dihydroeponemycin at 2.0 Angstrom
5LF7 2.0 Å, Human 20S proteasome complex with Ixazomib at 2.0 Angstrom
8UD9 2.04 Å, Structure of human constitutive 20S proteasome complexed with the inhibitor TDI-8304
5LF6 2.07 Å, Human 20S proteasome complex with Z-LLY-ketoaldehyde at 2.1 Angstrom
5LF3 2.1 Å, Human 20S proteasome complex with Bortezomib at 2.1 Angstrom
8BZL 2.14 Å, Human 20S Proteasome in complex with peptide activator peptide BLM42
5LEZ 2.19 Å, Human 20S proteasome complex with Oprozomib in Mg-Acetate at 2.2 Angstrom
5LEX 2.2 Å, Native human 20S proteasome in Mg-Acetate at 2.2 Angstrom

Browse structure collections

About this viewer

MolViewer shows 4R3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.