4R6U: IL-18 receptor complex

IL-18 receptor complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 15 Oct 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,101
Mol. weight: 111.41 kDa
Ligands: NAG
Released: 15 Oct 2014

Explore 4R6U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4R6U contains 23 α-helices and 74 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	27-31	5	7
β-strand	36-39	4	8
β-strand	55-59	5	7
β-strand	66-67	2	7
α-helix	68-69	2
β-strand	76-79	4	8
β-strand	82-85	4	8
α-helix	90-92	3
β-strand	94-99	6	7
β-strand	104-112	9	7
α-helix	122-124	3
β-strand	125-131	7	9
β-strand	135-139	5	10
α-helix	146-148	3
β-strand	149-156	8	9
β-strand	159-160	2	9
β-strand	170-174	5	10
α-helix	177-179	3
β-strand	181-191	11	9
β-strand	194-207	14	9
α-helix	208-210	3
β-strand	216-217	2	11
β-strand	222-226	5	12
β-strand	233-241	9	11
β-strand	246-250	5	12
β-strand	262-263	2	11
β-strand	267-270	4	11
α-helix	275	1
β-strand	276-284	9	11
β-strand	296-302	7	12
β-strand	305-314	10	12

Chains B and D: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	13
α-helix	18	1
β-strand	19-22	4	13
β-strand	28-31	4	13
α-helix	35-40	6
β-strand	47-54	8	13
β-strand	60-67	8	13
β-strand	71-75	5	13
α-helix	77-79	3
β-strand	82-84	3	13
α-helix	87-89	3
β-strand	91-92	2	13
β-strand	101-106	6	13
β-strand	109-117	9	13
β-strand	123-130	8	13
β-strand	133-140	8	13
α-helix	147-149	3
β-strand	151-154	4	13

Chain C: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	27-31	5	1
β-strand	36-39	4	2
β-strand	55-59	5	1
β-strand	66-67	2	1
β-strand	76-79	4	2
β-strand	82-85	4	2
α-helix	90-92	3
β-strand	94-100	7	1
β-strand	103-112	10	1
α-helix	122-124	3
β-strand	125-131	7	3
β-strand	135-139	5	4
α-helix	146-148	3
β-strand	149-156	8	3
β-strand	159-160	2	3
β-strand	170-174	5	4
α-helix	177-179	3
β-strand	181-191	11	3
β-strand	194-207	14	3
α-helix	208-210	3
β-strand	216-217	2	5
β-strand	222-226	5	6
β-strand	233-241	9	5
β-strand	246-250	5	6
β-strand	262-263	2	5
β-strand	266-270	5	5
α-helix	275	1
β-strand	276-284	9	5
β-strand	296-302	7	6
β-strand	305-314	10	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-18 receptor 1	A, C	protein	317	Homo sapiens	Q13478 (AlphaFold model)
Interleukin-18	B, D	protein	157	Homo sapiens	Q14116 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4R6U_1 Interleukin-18 receptor 1 (chains A, C)
AESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIAL
HDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFTERQVTSKIVEVKKFFQI
TCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFNI
TKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMFGEENGSD
PNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKAD
MADIPGHVFTRHHHHHH

Sequence of entity 2 (B, D), FASTA

>4R6U_2 Interleukin-18 (chains B, D)
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDSRDNAPRTIFIISMYKDSQPRGM
AVTISVKSEKISTLSSENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY
EGYFLASEKERDLFKLILKKEDELGDRSIMFTVQNED

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8

Primary citation

Structural basis for the specific recognition of IL-18 by its alpha receptor. Wei, H., Wang, D., Qian, Y. et al. FEBS Lett (2014) 588:3838-3843. DOI 10.1016/j.febslet.2014.09.019 · PubMed

Other PDB entries of the same protein (UniProt Q13478 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WO3 3.1 Å, Crystal structure of IL-18 in complex with IL-18 receptor alpha
3WO4 3.1 Å, Crystal structure of the IL-18 signaling ternary complex

Browse structure collections

About this viewer

MolViewer shows 4R6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.