4R7X: N-lobe of human ARRDC3(1-180)

Crystal structure of N-lobe of human ARRDC3(1-180). Determined by X-ray diffraction at 2.61 Å resolution. Released 1 Oct 2014.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,485
Mol. weight: 42.83 kDa
Ligands: PO4
Released: 1 Oct 2014

Explore 4R7X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4R7X contains 4 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	1
β-strand	23-24	2	2
β-strand	29-44	16	1
β-strand	46-63	18	3
β-strand	71-89	19	3
β-strand	103-117	15	1
α-helix	124-126	3
β-strand	127-128	2	3
β-strand	132-143	12	3
β-strand	150-156	7	3
β-strand	157-158	2	2
α-helix	160-162	3

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	4
β-strand	23-24	2	5
β-strand	29-39	11	4
β-strand	42-44	3	6
β-strand	46-63	18	3
β-strand	71-89	19	3
β-strand	103-105	3	6
β-strand	108-117	10	4
α-helix	124-126	3
β-strand	127-128	2	3
β-strand	132-143	12	3
β-strand	150-156	7	3
β-strand	157-158	2	5
α-helix	160-162	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arrestin domain-containing protein 3	A, B	protein	185	Homo sapiens	Q96B67 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4R7X_1 Arrestin domain-containing protein 3 (chains A, B)
GAMGSMVLGKVKSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHA
KVRWTESRNAGSNTAYTQNYTEEVEYFNHKDILIGHERDDDNSEEGFHTIHSGRHEYAFS
FELPQTPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLSPQAG
TKEKT

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	11

Primary citation

Insights into beta 2-adrenergic receptor binding from structures of the N-terminal lobe of ARRDC3. Qi, S., O'Hayre, M., Gutkind, J.S. et al. Protein Sci (2014) 23:1708-1716. DOI 10.1002/pro.2549 · PubMed

Other PDB entries of the same protein (UniProt Q96B67 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N7H 1.7 Å, Crystal Structure of the Complex of 3rd WW domain of Human Nedd4 and 1st PPXY Motif of…
4R7V 1.73 Å, Crystal structure of N-lobe of human ARRDC3(1-165)

Browse structure collections

About this viewer

MolViewer shows 4R7X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.