4REY: GRASP65-GM130 C-terminal peptide complex

Crystal Structure of the GRASP65-GM130 C-terminal peptide complex. Determined by X-ray diffraction at 1.96 Å resolution. Released 23 Sept 2015.

Method: X-ray diffraction
Resolution: 1.96 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,964
Mol. weight: 26.42 kDa
Released: 23 Sept 2015

Explore 4REY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4REY contains 7 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	15-22	8	1
α-helix	27-30	4
β-strand	38-43	6	1
β-strand	46-47	2	1
α-helix	54-61	8
β-strand	67-73	7	1
β-strand	78-84	7	1
β-strand	98-104	7	1
α-helix	108-110	3
β-strand	113-118	6	2
α-helix	123-127	5
β-strand	134-139	6	2
α-helix	142-144	3
α-helix	149-155	7
β-strand	161-167	7	2
β-strand	172-178	7	2
β-strand	192-195	4	2
α-helix	202-204	3

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	973-974	2	2
β-strand	988-989	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Golgi reassembly-stacking protein 1	A	protein	213	Homo sapiens	Q9BQQ3 (AlphaFold model)
Golgin subfamily A member 2	B	protein	27	Homo sapiens	Q08379 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4REY_1 Golgi reassembly-stacking protein 1 (chains A)
GPEIGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKA
LLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLD
VEPSSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVT
VTPNAAWGGEGSLGCGIGYGYLHRIPTQPPSYH

Sequence of entity 2 (B), FASTA

>4REY_2 Golgin subfamily A member 2 (chains B)
GPEFGSNPCIPFFYRADENDEVKITVI

Primary citation

Structural Basis for the Interaction between the Golgi Reassembly-stacking Protein GRASP65 and the Golgi Matrix Protein GM130. Hu, F., Shi, X., Li, B. et al. J Biol Chem (2015) 290:26373-26382. DOI 10.1074/jbc.M115.657940 · PubMed

Other PDB entries of the same protein (UniProt Q9BQQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G8W 2.12 Å, Crystal Structures of the Single PDZ Domains from GRASP65 and their Interaction with the…
6G8T 2.67 Å, Crystal Structures of the Single PDZ Domains from GRASP65 and their Interaction with the…

Browse structure collections

About this viewer

MolViewer shows 4REY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.