4RTA: Protein dpy-30 homolog

Cystal structure of the Dpy30 for MLL/SET1 COMPASS H3K4 trimethylation. Determined by X-ray diffraction at 2.12 Å resolution. Released 7 Oct 2015.

Method: X-ray diffraction
Resolution: 2.12 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,162
Mol. weight: 24.48 kDa
Released: 7 Oct 2015

Explore 4RTA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RTA contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	53-60	8
α-helix	62-75	14
α-helix	80-95	16

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	31-34	4
α-helix	48-50	3
α-helix	53-60	8
α-helix	62-75	14
α-helix	80-95	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein dpy-30 homolog	A, B	protein	106	Homo sapiens	Q9C005 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4RTA_1 Protein dpy-30 homolog (chains A, B)
MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQT
VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRNLERPHRD

Primary citation

Structural implications of Dpy30 oligomerization for MLL/SET1 COMPASS H3K4 trimethylation. Zhang, H., Li, M., Gao, Y. et al. Protein Cell (2015) 6:147-151. DOI 10.1007/s13238-014-0127-z · PubMed

Other PDB entries of the same protein (UniProt Q9C005 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3G36 1.2 Å, Crystal structure of the human DPY-30-like C-terminal domain
4RT4 2.0 Å, Crystal structure of Dpy30 complexed with Bre2
4RIQ 2.23 Å, Crystal structure of DPY-30 dimerization/docking domain in complex with Ash2L…
6E2H 2.24 Å, Crystal structure of human Ash2L (SPRY domain and SDI motif) in complex with full length…
9YM8 3.43 Å, State 2 focused on PHD FYR of MLL4FC bound to a nucleosome premodified with H2BK120ub…
9YMF 3.45 Å, State 2 focused on H3 N terminal tail of MLL4FC bound to a nucleosome premodified with…
9YL3 3.5 Å, State 1 MLL4FC bound to a nucleosome premodified with H2BK120ub and H4K16ac
9YLE 3.63 Å, State 3 MLL4FC bound to a nucleosome premodified with H2BK120ub and H4K16ac
9YLY 3.77 Å, MLL4FC bound to a nucleosome with p53 RE
7UD5 4.25 Å, Complex between MLL1-WRAD and an H2B-ubiquitinated nucleosome
6PWV 6.2 Å, Cryo-EM structure of MLL1 core complex bound to the nucleosome

Browse structure collections

About this viewer

MolViewer shows 4RTA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.