4TVX: CRISPR system Cascade subunit CasB

Crystal structure of the E. coli CRISPR RNA-guided surveillance complex, Cascade. Determined by X-ray diffraction at 3.24 Å resolution. Released 13 Aug 2014.

Method: X-ray diffraction
Resolution: 3.24 Å
Organism: Escherichia coli
Chains: 24
Atoms: 53,269
Mol. weight: 804.32 kDa
Ligands: ZN
Released: 13 Aug 2014

Explore 4TVX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4TVX contains 340 α-helices and 307 β-strands across 22 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	38
α-helix	10-12	3
α-helix	16-24	9
β-strand	37-43	7	38
β-strand	50-56	7	38
β-strand	66-73	8	38
β-strand	83-90	8	39
β-strand	93-96	4	40
β-strand	103-104	2	41
β-strand	108-109	2	41
β-strand	112-115	4	40
α-helix	119-130	12
α-helix	131-133	3
β-strand	134-143	10	39
α-helix	145-146	2
β-strand	147-148	2	42
β-strand	157-158	2	42
β-strand	161-169	9	39
α-helix	172-181	10
α-helix	187-189	3
β-strand	194-198	5	39

Chain B: 20 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4-13	10	28
β-strand	20	1	29
β-strand	26	1	29
β-strand	28-31	4	30
β-strand	34-37	4	30
β-strand	38-39	2	28
α-helix	41-49	9
α-helix	52-57	6
α-helix	60-62	3
β-strand	63-65	3	31
α-helix	69-79	11
α-helix	85-95	11
β-strand	112-114	3	31
α-helix	116-125	10
α-helix	127-131	5
α-helix	133-135	3
α-helix	136-145	10
α-helix	148-153	6
α-helix	158-163	6
β-strand	165	1	32
α-helix	172-175	4
β-strand	178	1	32
β-strand	182-184	3	28
α-helix	185-186	2
β-strand	187-189	3	28
α-helix	199-202	4
β-strand	222-231	10	28
α-helix	232-238	7
α-helix	244-260	17
α-helix	263-265	3
β-strand	278-284	7	28
α-helix	291-294	4
α-helix	305-323	19
β-strand	329-332	4	28
β-strand	345-347	3	28
α-helix	350-358	9

Chain C: 21 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-12	9	22
β-strand	16	1	23
β-strand	20	1	24
α-helix	25	1
β-strand	26	1	24
α-helix	27	1
β-strand	28-31	4	25
β-strand	34-37	4	25
β-strand	38-39	2	22
α-helix	41-49	9
α-helix	52-57	6
α-helix	60-62	3
β-strand	63-67	5	26
α-helix	68-79	12
α-helix	85-95	11
β-strand	107-114	8	26
α-helix	116-132	17
α-helix	133-135	3
α-helix	136-142	7
α-helix	147-152	6
α-helix	153-155	3
α-helix	159-163	5
α-helix	172-175	4
β-strand	182-184	3	22
α-helix	185-186	2
β-strand	187-189	3	22
β-strand	196-200	5	27
β-strand	215-219	5	27
β-strand	220	1	23
β-strand	223-231	9	22
α-helix	232-238	7
α-helix	244-260	17
β-strand	276-284	9	22
α-helix	291-294	4
α-helix	297-300	4
α-helix	305-323	19
β-strand	329-333	5	22
β-strand	345-347	3	22
α-helix	350-358	9

Chain D: 19 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-12	9	10
β-strand	16	1	11
β-strand	20	1	12
β-strand	26	1	12
β-strand	28-31	4	13
β-strand	34-37	4	13
β-strand	38-39	2	10
α-helix	41-49	9
α-helix	52-57	6
α-helix	60-62	3
β-strand	63-67	5	14
α-helix	68-79	12
α-helix	85-95	11
β-strand	107-114	8	14
α-helix	116-132	17
α-helix	133-135	3
α-helix	136-145	10
α-helix	147-152	6
α-helix	153-155	3
α-helix	159-163	5
β-strand	182-184	3	10
α-helix	185-186	2
β-strand	187-189	3	10
β-strand	196-202	7	15
β-strand	213-219	7	15
β-strand	220	1	11
β-strand	223-231	9	10
α-helix	232-238	7
α-helix	244-260	17
β-strand	278-284	7	10
α-helix	291-294	4
α-helix	297-300	4
α-helix	305-323	19
β-strand	329-333	5	10
α-helix	339-340	2
β-strand	345-347	3	10
α-helix	350-358	9

Chain E: 21 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	16
β-strand	20	1	17
α-helix	25	1
β-strand	26	1	17
α-helix	27	1
β-strand	28-31	4	18
β-strand	34-37	4	18
β-strand	38-39	2	16
α-helix	41-49	9
α-helix	52-57	6
α-helix	60-62	3
β-strand	63-67	5	19
α-helix	68-79	12
α-helix	85-95	11
β-strand	107-114	8	19
α-helix	116-132	17
α-helix	133-135	3
α-helix	136-145	10
α-helix	147-152	6
α-helix	153-155	3
α-helix	158-163	6
β-strand	165	1	20
α-helix	172-175	4
β-strand	178	1	20
β-strand	182-184	3	16
α-helix	185-186	2
β-strand	187-189	3	16
β-strand	196-201	6	21
β-strand	214-219	6	21
β-strand	220-231	12	16
α-helix	232-238	7
α-helix	244-260	17
β-strand	278-284	7	16
α-helix	291-294	4
α-helix	297-300	4
α-helix	305-323	19
β-strand	329-333	5	16
β-strand	345-347	3	16
α-helix	350-358	9

Chain F: 19 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	5
β-strand	20	1	6
β-strand	26	1	6
β-strand	28-31	4	7
β-strand	34-37	4	7
β-strand	38-39	2	5
α-helix	41-49	9
α-helix	52-57	6
α-helix	60-62	3
β-strand	63-67	5	8
α-helix	68-79	12
α-helix	85-95	11
β-strand	107-114	8	8
α-helix	116-127	12
α-helix	136-145	10
α-helix	147-152	6
α-helix	153-155	3
α-helix	158-163	6
α-helix	172-175	4
β-strand	182-184	3	5
α-helix	185-186	2
β-strand	187-189	3	5
β-strand	196-200	5	9
β-strand	215-219	5	9
β-strand	220-231	12	5
α-helix	232-238	7
α-helix	244-260	17
β-strand	278-284	7	5
α-helix	291-294	4
α-helix	297-300	4
α-helix	305-323	19
β-strand	329-333	5	5
α-helix	344	1
β-strand	345-347	3	5
α-helix	350-358	9

Chain G: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4-16	13	33
β-strand	20	1	34
β-strand	26	1	34
β-strand	28-31	4	35
β-strand	34-37	4	35
β-strand	38-39	2	33
α-helix	41-49	9
α-helix	52-54	3
α-helix	55-59	5
α-helix	65-67	3
α-helix	72-80	9
α-helix	85-95	11
α-helix	113-132	20
α-helix	136-142	7
α-helix	144-153	10
α-helix	157-163	7
β-strand	182-184	3	33
α-helix	185-186	2
β-strand	187-189	3	33
β-strand	196-202	7	36
β-strand	204	1	37
β-strand	207	1	37
β-strand	213-219	7	36
β-strand	220-231	12	33
α-helix	232-239	8
α-helix	244-260	17
β-strand	278-284	7	33
α-helix	291-294	4
α-helix	297-300	4
α-helix	305-322	18
β-strand	329-333	5	33
β-strand	345-346	2	33
α-helix	350-358	9

Chain H: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	43
β-strand	14	1	44
β-strand	25	1	44
α-helix	33-44	12
α-helix	51-60	10
β-strand	61-68	8	43
β-strand	70-72	3	45
β-strand	75-77	3	45
β-strand	80-89	10	44
β-strand	103-112	10	44
β-strand	115-122	8	43
α-helix	130-138	9
β-strand	158-164	7	43
α-helix	167-171	5
β-strand	181-183	3	43
β-strand	193-200	8	43
β-strand	208-216	9	43

14 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRISPR system Cascade subunit CasB	J, K, V, W	protein	165	Escherichia coli	P76632 (AlphaFold model)
CRISPR system Cascade subunit CasC	B, C, D, E, F, G, N, O, P, Q, R, S	protein	363	Escherichia coli	Q46899 (AlphaFold model)
CRISPR system Cascade subunit CasE	A, M	protein	199	Escherichia coli	Q46897 (AlphaFold model)
CRISPR system Cascade subunit CasD	H, T	protein	224	Escherichia coli	Q46898 (AlphaFold model)
Escherichia coli strain ECOR44 cluster 1 CRISPR region	L, X	RNA	61	Escherichia coli
CRISPR system Cascade subunit CasA	I, U	protein	502	Escherichia coli	Q46901

Sequence of entity 1 (J, K, V, W), FASTA

>4TVX_1 CRISPR system Cascade subunit CasB (chains J, K, V, W)
GPGYQMADEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQ
QALLRMVFCLSAGKNVIRHQDKKSEQTTGISLGRALANSGRINERRIFQLIRADRTADMV
QLRRLLTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKNA

Sequence of entity 2 (B, C, D, E, F, G, N, O, P, Q, R, S), FASTA

>4TVX_2 CRISPR system Cascade subunit CasC (chains B, C, D, E, F, G, N, O, P, Q, R, S)
MSNFINIHVLISHSPSCLNRDDMNMQKDAIFGGKRRVRISSQSLKRAMRKSGYYAQNIGE
SSLRTIHLAQLRDVLRQKLGERFDQKIIDKTLALLSGKSVDEAEKISADAVTPWVVGEIA
WFCEQVAKAEADNLDDKKLLKVLKEDIAAIRVNLQQGVDIALSGRMATSGMMTELGKVDG
AMSIAHAITTHQVDSDIDWFTAVDDLQEQGSAHLGTQEFSSGVFYRYANINLAQLQENLG
GASREQALEIATHVVHMLATEVPGAKQRTYAAFNPADMVMVNFSDMPLSMANAFEKAVKA
KDGFLQPSIQAFNQYWDRVANGYGLNGAAAQFSLSDVDPITAQVKQMPTLEQLKSWVRNN
GEA

Sequence of entity 3 (A, M), FASTA

>4TVX_3 CRISPR system Cascade subunit CasE (chains A, M)
MYLSKVIIARAWSRDLYQLHQGLWHLFPNRPDAARDFLFHVEKRNTPEGCHVLLQSAQMP
VSTAVATVIKTKQVEFQLQVGVPLYFRLRANPIKTILDNQKRLDSKGNIKRCRVPLIKEA
EQIAWLQRKLGNAARVEDVHPISERPQYFSGDGKSGKIQTVCFEGVLTINDAPALIDLVQ
QGIGPAKSMGCGLLSLAPL

Sequence of entity 4 (H, T), FASTA

>4TVX_4 CRISPR system Cascade subunit CasD (chains H, T)
MRSYLILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSES
VQFAVRCDELILDDRRVSVTGLRDYHTVLGAREDYRGLKSHETIQTWREYLCDASFTVAL
WLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQASDPQKALLNYEPVGGD
IYSEESVTGHHLKFTARDEPMITLPRQFASREWYVIKGGMDVSQ

Sequence of entity 5 (L, X), FASTA

>4TVX_5 Escherichia coli strain ECOR44 cluster 1 CRISPR region (chains L, X)
AUAAACCGACGGUAUUGUUCAGAUCCUGGCUUGCCAACAGGAGUUCCCCGCGCCAGCGGG
X

Sequence of entity 6 (I, U), FASTA

>4TVX_6 CRISPR system Cascade subunit CasA (chains I, U)
MNLLIDNWIPVRPRNGGKVQIINLQSLYCSRDQWRLSLPRDDMELAALALLVCIGQIIAP
AKDDVEFRHRIMNPLTEDEFQQLIAPWIDMFYLNHAEHPFMQTKGVKANDVTPMEKLLAG
VSGATNCAFVNQPGQGEALCGGCTAIALFNQANQAPGFGGGFKSGLRGGTPVTTFVRGID
LRSTVLLNVLTLPRLQKQFPNESHTENQPTWIKPIKSNESIPASSIGFVRGLFWQPAHIE
LCDPIGIGKCSCCGQESNLRYTGFLKEKFTFTVNGLWPHPHSPCLVTVKKGEVEEKFLAF
TTSAPSWTQISRVVVDKIIQNENGNRVAAVVNQFRNIAPQSPLELIMGGYRNNQASILER
RHDVLMFNQGWQQYGNVINEIVTVGLGYKTALRKALYTFAEGFKNKDFKGAGVSVHETAE
RHFYRQSELLIPDVLANVNFSQADEVIADLRDKLHQLCEMLFNQSVAPYAHHPKLISTLA
LARATLYKHLRELKPQGGPSNG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural biology. Crystal structure of the CRISPR RNA-guided surveillance complex from Escherichia coli. Jackson, R.N., Golden, S.M., van Erp, P.B. et al. Science (2014) 345:1473-1479. DOI 10.1126/science.1256328 · PubMed

Other PDB entries of the same protein (UniProt P76632 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H9F 2.45 Å, Crystal structure of E. coli Cascade bound to a PAM-containing dsDNA target at 2.45…
4U7U 3.0 Å, Crystal structure of RNA-guided immune Cascade complex from E.coli
4QYZ 3.03 Å, Crystal structure of a CRISPR RNA-guided surveillance complex, Cascade, bound to a ssDNA…
5CD4 3.2 Å, The Type IE CRISPR Cascade complex from E. coli, with two assemblies in the asymmetric…
5H9E 3.21 Å, Crystal structure of E. coli Cascade bound to a PAM-containing dsDNA target (32-nt…

Browse structure collections

About this viewer

MolViewer shows 4TVX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.