4U1P: Human Fyn-SH2 domain

Human Fyn-SH2 domain in complex with a synthetic high-affinity phospho-peptide. Determined by X-ray diffraction at 1.4 Å resolution. Released 29 Jul 2015.

Method: X-ray diffraction
Resolution: 1.4 Å
Organisms: Homo sapiens, Hamster polyomavirus
Chains: 2
Atoms: 1,166
Mol. weight: 17.15 kDa
Ligands: 15P
Released: 29 Jul 2015

Explore 4U1P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U1P contains 4 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	1
α-helix	30-37	8
α-helix	42-43	2
β-strand	46-51	6	1
β-strand	59-67	9	1
β-strand	71-79	9	1
β-strand	80-81	2	2
α-helix	82	1
β-strand	87-88	2	2
β-strand	94-95	2	2
α-helix	98-107	10
β-strand	118-119	2	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase Fyn	A	protein	122	Homo sapiens	P06241 (AlphaFold model)
Middle T antigen	B	protein	11	Hamster polyomavirus	P03079

Sequence of entity 1 (A), FASTA

>4U1P_1 Tyrosine-protein kinase Fyn (chains A)
MGSSHHHHHHSSGLVPRGSHMEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYS
LSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPC
HK

Sequence of entity 2 (B), FASTA

>4U1P_2 Middle T antigen (chains B)
EPQYEEIPIYL

Ligands and cofactors

ID	Name	Formula	Copies
15P	Polyethylene glycol (N=34)	C69 H140 O35	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Human Fyn-SH2 domain in complex with a synthetic high-affinity phospho-peptide. Garcia-Pino, A., Huculeci, R., Lenaerts, T. et al. To be published.

Other PDB entries of the same protein (UniProt P06241 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A2P 0.9 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 5.0…
7A2X 0.92 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex…
7A2O 0.94 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 4.5
7A2Q 0.94 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 3.0…
7A2Y 0.97 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex…
7A2W 0.99 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex…
8KDX 1.01 Å, Tau-S214 Phosphorylation Inhibits Fyn Kinase Interaction and Increases the Decay Time of…
7A2S 1.02 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 5.0
7A2R 1.05 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 6.0
7A2Z 1.14 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex…
7A2T 1.22 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 4.0
6IPY 1.34 Å, His-tagged Fyn SH3 domain R96I mutant

Browse structure collections

About this viewer

MolViewer shows 4U1P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.