4U2X: Ebola virus VP24

Ebola virus VP24 in complex with Karyopherin alpha 5 C-terminus. Determined by X-ray diffraction at 3.15 Å resolution. Released 13 Aug 2014.

Method: X-ray diffraction
Resolution: 3.15 Å
Organisms: Zaire ebolavirus, Homo sapiens
Chains: 6
Atoms: 9,199
Mol. weight: 131.77 kDa
Released: 13 Aug 2014

Explore 4U2X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U2X contains 69 α-helices and 30 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	17-26	10
β-strand	28	1	1
β-strand	30-33	4	2
β-strand	37-42	6	2
β-strand	45-50	6	2
α-helix	54-62	9
α-helix	71-75	5
α-helix	77-80	4
β-strand	85-87	3	3
α-helix	90-105	16
α-helix	113-128	16
β-strand	133	1	1
α-helix	139-144	6
α-helix	147-165	19
α-helix	167-169	3
β-strand	178-182	5	3
β-strand	187-192	6	3
β-strand	197-202	6	3
α-helix	207-209	3
β-strand	217-222	6	3
α-helix	224-228	5

Chain C: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	17-26	10
β-strand	28	1	7
β-strand	30-33	4	8
β-strand	37-42	6	8
β-strand	45-50	6	8
α-helix	54-62	9
α-helix	70-75	6
α-helix	77-80	4
β-strand	85-87	3	9
α-helix	90-105	16
α-helix	113-128	16
β-strand	133	1	7
α-helix	139-144	6
α-helix	147-165	19
α-helix	167-169	3
β-strand	178-182	5	9
β-strand	187-192	6	9
β-strand	197-202	6	9
α-helix	207-209	3
β-strand	217-222	6	9
α-helix	224-228	5

Chain D: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	342-347	6
α-helix	353-367	15
α-helix	371-379	9
α-helix	383-392	10
α-helix	395-411	17
α-helix	414-423	10
α-helix	426-431	6
α-helix	432-434	3
α-helix	438-460	23
α-helix	468-475	8
α-helix	478-485	8
α-helix	491-504	14

Chains E and F: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	342-347	6
α-helix	353-367	15
α-helix	371-379	9
α-helix	383-392	10
α-helix	395-411	17
α-helix	414-423	10
α-helix	426-431	6
α-helix	432-434	3
α-helix	438-462	25
α-helix	468-475	8
α-helix	478-485	8
α-helix	491-504	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated protein VP24	A, B, C	protein	216	Zaire ebolavirus	Q05322 (AlphaFold model)
Importin subunit alpha-6	D, E, F	protein	175	Homo sapiens	O15131 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4U2X_1 Membrane-associated protein VP24 (chains A, B, C)
DLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWSMTRNL
FPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFN
MRTQRVKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNM
GFLVELQEPDKSAMNRMKPGPAKFSLLHESTLKAFT

Sequence of entity 2 (D, E, F), FASTA

>4U2X_2 Importin subunit alpha-6 (chains D, E, F)
TQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQ
KAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENI
LRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFG

Primary citation

Ebola Virus VP24 Targets a Unique NLS Binding Site on Karyopherin Alpha 5 to Selectively Compete with Nuclear Import of Phosphorylated STAT1. Xu, W., Edwards, M.R., Borek, D.M. et al. Cell Host Microbe (2014) 16:187-200. DOI 10.1016/j.chom.2014.07.008 · PubMed

Other PDB entries of the same protein (UniProt Q05322 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M0Q 1.92 Å, Ebola virus VP24 structure
8Y9J 4.6 Å, Structure of the Ebola virus nucleocapsid subunit
6EHM 7.3 Å, Model of the Ebola virus nucleocapsid subunit from recombinant virus-like particles
8UST 7.3 Å, In-virion structure of Ebola virus nucleocapsid-like assemblies from recombinant…
8USN 8.9 Å, Intracellular cryo-tomography structure of EBOV nucleocapsid at 8.9 Angstrom

Browse structure collections

About this viewer

MolViewer shows 4U2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.