4U32: Human mesotrypsin

Human mesotrypsin complexed with HAI-2 Kunitz domain 1. Determined by X-ray diffraction at 1.65 Å resolution. Released 15 Oct 2014.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,400
Mol. weight: 30.82 kDa
Ligands: NAG, CA
Released: 15 Oct 2014

Explore 4U32 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U32 contains 9 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	3
β-strand	20-21	2	1
α-helix	22-23	2
β-strand	30-34	5	4
β-strand	40-46	7	4
β-strand	51-54	4	4
α-helix	56-58	3
β-strand	64-67	4	4
β-strand	72	1	5
β-strand	81-90	10	4
β-strand	104-108	5	4
α-helix	111-114	4
β-strand	115	1	6
β-strand	118	1	6
β-strand	122	1	1
α-helix	123-124	2
β-strand	135-140	6	1
β-strand	154	1	5
β-strand	156-162	7	1
α-helix	163-164	2
α-helix	165-171	7
β-strand	180-183	4	1
β-strand	189	1	3
β-strand	198-201	4	1
β-strand	204-215	8	1
β-strand	226-230	5	1
α-helix	231-234	4
α-helix	235-244	10

Chain X: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	14	1	1
β-strand	18-24	7	2
β-strand	29-35	7	2
β-strand	45	1	2
α-helix	48-54	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kunitz-type protease inhibitor 2	X	protein	55	Homo sapiens	O43291 (AlphaFold model)
Trypsin-3	A	protein	224	Homo sapiens	P35030 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>4U32_1 Kunitz-type protease inhibitor 2 (chains X)
IHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKC

Sequence of entity 2 (A), FASTA

>4U32_2 Trypsin-3 (chains A)
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEG
NEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISG
WGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGP
VVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
CA	Calcium ion	Ca	1

Primary citation

Sequence and Conformational Specificity in Substrate Recognition: SEVERAL HUMAN KUNITZ PROTEASE INHIBITOR DOMAINS ARE SPECIFIC SUBSTRATES OF MESOTRYPSIN. Pendlebury, D., Wang, R., Henin, R.D. et al. J Biol Chem (2014) 289:32783-32797. DOI 10.1074/jbc.M114.609560 · PubMed

Browse structure collections

About this viewer

MolViewer shows 4U32 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.