4UEG: Human glycogenin-2 catalytic domain

Crystal structure of human glycogenin-2 catalytic domain. Determined by X-ray diffraction at 1.93 Å resolution. Released 24 Dec 2014.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 4,217
Mol. weight: 66.25 kDa
Ligands: MG
Released: 24 Dec 2014

Explore 4UEG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UEG contains 37 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
α-helix	18-30	13
β-strand	36-41	6	1
α-helix	47-53	7
β-strand	59-62	4	1
α-helix	70-78	9
α-helix	80-82	3
α-helix	83-89	7
α-helix	90-93	4
β-strand	99-103	5	1
β-strand	107-109	3	2
α-helix	114-118	5
α-helix	120	1
β-strand	123-126	4	1
α-helix	127	1
β-strand	134-141	8	1
α-helix	145-158	14
α-helix	165-172	8
α-helix	181-183	3
β-strand	184	1	1
α-helix	187-189	3
β-strand	191	1	2
α-helix	201-206	6
α-helix	207-209	3
β-strand	212-214	3	2
α-helix	221-223	3
α-helix	246-255	10
α-helix	256-260	5
α-helix	261-267	7

Chain B: 18 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	3
α-helix	18-30	13
β-strand	36-41	6	3
α-helix	47-53	7
β-strand	59-62	4	3
α-helix	70-78	9
α-helix	80-82	3
α-helix	83-89	7
α-helix	90-93	4
β-strand	99-103	5	3
β-strand	107-109	3	4
α-helix	114-118	5
β-strand	123-126	4	3
α-helix	127	1
β-strand	134-141	8	3
α-helix	145-158	14
α-helix	165-172	8
α-helix	181-183	3
β-strand	184	1	3
α-helix	187-189	3
β-strand	191-192	2	4
α-helix	201-206	6
α-helix	207-209	3
β-strand	212-214	3	4
α-helix	221-224	4
α-helix	243-255	13
α-helix	256-260	5
α-helix	261-264	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogenin-2	A, B	protein	288	HOMO SAPIENS	O15488 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4UEG_1 GLYCOGENIN-2 (chains A, B)
MTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSDLLRRILSKVFDEVIE
VNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEF
SAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIH
KHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSS
QHQAAFLHLWWTVYQNNVLPLYKSVQAENLYFQSHHHHHHDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

Crystal Structure of Human Glycogenin-2 Catalytic Domain. Fairhead, M., Strain-Damerell, C., Krojer, T. et al. To be published.

Other PDB entries of the same protein (UniProt O15488 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Z0A 2.84 Å, Human GYS1-GYG2 complex (apo)

Browse structure collections

About this viewer

MolViewer shows 4UEG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.