4UF7: Glycoprotein

Ghanaian henipavirus (Gh-M74a) attachment glycoprotein in complex with human ephrinB2. Determined by X-ray diffraction at 1.7 Å resolution. Released 1 Apr 2015.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: BAT PARAMYXOVIRUS EID_HEL/GH-M74A/GHA/2009, Homo sapiens
Chains: 4
Atoms: 10,304
Mol. weight: 143.85 kDa
Ligands: NAG
Released: 1 Apr 2015

Explore 4UF7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UF7 contains 28 α-helices and 96 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	202-205	4
β-strand	215-219	5	1
β-strand	231-241	11	1
β-strand	244-253	10	1
α-helix	256-258	3
β-strand	261-273	13	1
β-strand	279-282	4	1
β-strand	286-288	3	1
α-helix	292-294	3
β-strand	295-302	8	2
β-strand	306-313	8	2
α-helix	319-322	4
α-helix	325-327	3
β-strand	329-336	8	2
β-strand	342-347	6	2
α-helix	348-350	3
β-strand	352-353	2	3
β-strand	357-362	6	3
β-strand	364-366	3	4
β-strand	368-370	3	3
β-strand	373-382	10	3
α-helix	401-407	7
β-strand	411	1	5
β-strand	414	1	5
β-strand	419-427	9	3
β-strand	435-440	6	3
β-strand	452-457	6	4
β-strand	460-465	6	4
β-strand	475-481	7	4
α-helix	482-484	3
β-strand	486-489	4	4
α-helix	490-491	2
β-strand	515	1	6
β-strand	519	1	1
β-strand	521-523	3	7
β-strand	531-536	6	7
β-strand	545-550	6	7
β-strand	555-560	6	7
β-strand	565-578	14	1
β-strand	581-592	12	1
β-strand	597-598	2	1
β-strand	601-607	7	1

Chain B: 9 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	203-205	3
β-strand	215-219	5	8
β-strand	231-241	11	9
β-strand	244-253	10	9
α-helix	256-258	3
β-strand	261-273	13	9
β-strand	279-282	4	9
β-strand	287	1	9
α-helix	292-294	3
β-strand	295-302	8	10
β-strand	307-313	7	10
α-helix	319-322	4
α-helix	325-327	3
β-strand	329-335	7	10
β-strand	342-347	6	10
α-helix	348-350	3
β-strand	352-353	2	11
β-strand	357-362	6	11
β-strand	364-366	3	12
β-strand	368-370	3	11
β-strand	373-382	10	11
α-helix	401-407	7
β-strand	419-427	9	11
β-strand	435-440	6	11
β-strand	452-457	6	12
β-strand	460-465	6	12
β-strand	475-481	7	12
α-helix	482-484	3
β-strand	486-489	4	12
α-helix	490-491	2
β-strand	515	1	13
β-strand	519	1	8
β-strand	521-523	3	14
β-strand	531-536	6	14
β-strand	545-550	6	14
β-strand	555-560	6	14
β-strand	565-578	14	8
β-strand	581-592	12	8
β-strand	597-598	2	8
β-strand	601-607	7	8

Chain C: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	31-37	7	1
β-strand	46	1	15
β-strand	50	1	15
β-strand	51-53	3	16
α-helix	55-56	2
β-strand	60-65	6	1
α-helix	66-68	3
β-strand	78	1	17
β-strand	79-81	3	18
β-strand	82-84	3	16
α-helix	86-90	5
β-strand	93	1	19
β-strand	102-104	3	18
β-strand	111-116	6	1
β-strand	123	1	13
β-strand	133-138	6	16
β-strand	143	1	17
α-helix	145-147	3
β-strand	152	1	19
α-helix	154-158	5
β-strand	162-167	6	16

Chain E: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	31-37	7	20
β-strand	46	1	21
β-strand	50	1	21
β-strand	51-53	3	22
α-helix	55-56	2
β-strand	59-65	7	20
α-helix	66-68	3
β-strand	78	1	23
β-strand	79-81	3	24
β-strand	82-84	3	22
α-helix	86-90	5
β-strand	93	1	25
β-strand	102-104	3	24
β-strand	111-116	6	20
β-strand	123	1	6
β-strand	133-138	6	22
β-strand	143	1	23
α-helix	145-147	3
β-strand	152	1	25
α-helix	154-158	5
β-strand	162-167	6	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycoprotein	A, B	protein	454	BAT PARAMYXOVIRUS EID_HEL/GH-M74A/GHA/2009	I0E093 (AlphaFold model)
Ephrin-B2	C, E	protein	153	Homo sapiens	P52799 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4UF7_1 GLYCOPROTEIN (chains A, B)
ETGAHGPSPCRNFSSVPTIYYYRIPGLYNRTALDERCILNPRLTISSTKFAYVHSEYDKN
CTRGFKYYELMTFGEILEGPEKEPRMFSRSFYSPTNAVNYHSCTPIVTVNEGYFLCLECT
SSDPLYKANLSNSTFHLVILRHNKDEKIVSMPSFNLSTDQEYVQIIPAEGGGTAESGNLY
FPCIGRLLHKRVTHPLCKKSNCSRTDDESCLKSYYNQGSPQHQVVNCLIRIRNAQRDNPT
WDVITVDLTNTYPGSRSRIFGSFSKPMLYQSSVSWHTLLQVAEITDLDKYQLDWLDTPYI
SRPGGSECPFGNYCPTVCWEGTYNDVYSLTPNNDLFVTVYLKSEQVAENPYFAIFSRDQI
LKEFPLDAWISSARTTTISCFMFNNEIWCIAALEITRLNDDIIRPIYYSFWLPTDCRTPY
PHTGKMTRVPLRSTYNYPYDVPDYAGTKHHHHHH

Sequence of entity 2 (C, E), FASTA

>4UF7_2 EPHRIN-B2 (chains C, E)
ETGSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDK
DQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLE
GLDNQEGGVCQTRAMKILMKVGQDGTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	11

Water and common crystallization additives (CL, ACT, SO4) are not listed.

Primary citation

Molecular Recognition of Human Ephrinb2 Cell Surface Receptor by an Emergent African Henipavirus. Lee, B., Pernet, O., Ahmed, A.A. et al. Proc Natl Acad Sci U S A (2015) 112:E2156. DOI 10.1073/PNAS.1501690112 · PubMed

Browse structure collections

About this viewer

MolViewer shows 4UF7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.