4UFS: Low resolution structure R-spondin-2

Low resolution structure R-spondin-2 (Fu1Fu2) in complex with the ectodomains of LGR5 and ZNRF3. Determined by X-ray diffraction at 4.8 Å resolution. Released 8 Jul 2015.

Method: X-ray diffraction
Resolution: 4.8 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 5,582
Mol. weight: 86.26 kDa
Released: 8 Jul 2015

Explore 4UFS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UFS contains 17 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	39-42	4	1
β-strand	48-51	4	1
β-strand	68-72	5	1
β-strand	94-96	3	1
β-strand	118-120	3	1
β-strand	128	1	2
β-strand	142-144	3	1
β-strand	152	1	2
β-strand	166-168	3	1
α-helix	179-182	4
β-strand	190-192	3	1
β-strand	200-201	2	3
β-strand	214-216	3	1
β-strand	224-225	2	3
β-strand	238-240	3	1
α-helix	251-255	5
β-strand	261-263	3	1
β-strand	271-272	2	4
α-helix	273	1
β-strand	285-287	3	1
β-strand	295-296	2	4
β-strand	309-313	5	5
α-helix	321-323	3
β-strand	332-336	5	5
α-helix	347-350	4
β-strand	356-358	3	5
β-strand	378-380	3	5
β-strand	388-389	2	6
α-helix	392-394	3
β-strand	402-404	3	5
β-strand	412-413	2	6
α-helix	415-418	4
β-strand	426-428	3	5
β-strand	447-449	3	5
β-strand	470-472	3	5
α-helix	476-480	5
β-strand	540-542	3	5

Chain B: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	43-47	5	7
β-strand	51-55	5	7
α-helix	59	1
β-strand	60-66	7	7
β-strand	69-75	7	7
α-helix	78-79	2
β-strand	82-85	4	7
β-strand	92-95	4	7
β-strand	101-106	6	8
β-strand	109-113	5	8
β-strand	118-120	3	9
β-strand	123-125	3	9
α-helix	128-129	2
β-strand	135	1	9
β-strand	140	1	9

Chain C: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	54	1
β-strand	55-65	11	10
β-strand	71-83	13	10
β-strand	91-97	7	10
α-helix	100-102	3
β-strand	117-122	6	10
α-helix	126-128	3
α-helix	136-145	10
β-strand	148-154	7	10
α-helix	160-165	6
β-strand	177-180	4	10
α-helix	183-194	12
β-strand	199-204	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat-containing G-protein coupled receptor 5	A	protein	484	HOMO SAPIENS	O75473 (AlphaFold model)
R-spondin-2	B	protein	120	HOMO SAPIENS	Q8BFU0 (AlphaFold model)
E3 ubiquitin-protein ligase ZNRF3	C	protein	165	HOMO SAPIENS	Q9ULT6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4UFS_1 LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED RECEPTOR 5 (chains A)
ETLRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPS
LRFLEELRLAGNALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDAN
HISYVPPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGN
LSSLVVLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNN
IRSIPEKAFVGNPSLITIHFYDNPIQFVGRSAFQHLPELRTLTLNGASQITEFPDLTGTA
NLESLTLTGAQISSLPQTVCNQLPNLQVLDLSYNLLEDLPSFSVCQKLQKIDLRHNEIYE
IKVDTFQQLLSLRSLNLAWNKIAIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHL
KLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENNGNNGDSVQCSPSGTHHHHHH
HHHH

Sequence of entity 2 (B), FASTA

>4UFS_2 R-SPONDIN-2 (chains B)
ETGICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCAR
CRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLDETMECVEGTHHHHHHHHHH

Sequence of entity 3 (C), FASTA

>4UFS_3 E3 UBIQUITIN-PROTEIN LIGASE ZNRF3 (chains C)
ETGKETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDE
EDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGS
EDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLGTKHHHHHH

Primary citation

Crystal Structure of R-Spondin 2 in Complex with the Ectodomains of its Receptors Lgr5 and Znrf3. Zebisch, M., Yvonne Jones, E. J Struct Biol (2015) 191:149. DOI 10.1016/J.JSB.2015.05.008 · PubMed

Other PDB entries of the same protein (UniProt O75473 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UFR 2.2 Å, Structure of the ectodomain of LGR5 in complex with R-spondin-2 (Fu1Fu2)
4KNG 2.5 Å, Crystal structure of human LGR5-RSPO1-RNF43
4BSR 3.2 Å, Structure of the ectodomain of LGR5 in complex with R-spondin-1 (Fu1Fu2) in P22121…
4BSS 3.2 Å, Structure of the ectodomain of LGR5 in complex with R-spondin-1 (Fu1Fu2) in P21 crystal…
4BSU 3.2 Å, Structure of the ectodomain of LGR5 in complex with R-spondin-1 (Fu1Fu2) in C2 crystal…
4BST 4.3 Å, Structure of the ectodomain of LGR5 in complex with R-spondin-1 (Fu1Fu2) in P6122…

Browse structure collections

About this viewer

MolViewer shows 4UFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.