Crystal structure of the Pygo2 PHD finger in complex with the B9L HD1 domain and a chemical fragment. Determined by X-ray diffraction at 1.65 Å resolution. Released 5 Nov 2014.
Explore 4UP5 in 3D Show helices and sheets RCSB PDB PDBe
4UP5 contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 329 | 1 | 1 |
| β-strand | 336 | 1 | 1 |
| β-strand | 343-345 | 3 | 2 |
| β-strand | 346 | 1 | 3 |
| β-strand | 353-355 | 3 | 2 |
| α-helix | 356-359 | 4 | |
| α-helix | 363-371 | 9 | |
| β-strand | 375-377 | 3 | 3 |
| β-strand | 1236-1238 | 3 | 3 |
| α-helix | 1240-1251 | 12 | |
| α-helix | 1258-1261 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pygopus homolog 2, B-cell cll/lymphoma 9-like protein | A | protein | 99 | HOMO SAPIENS | Q86UU0 (AlphaFold model), Q9BRQ0 (AlphaFold model) |
>4UP5_1 PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN (chains A) GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKT KEGSGSGSGSVYVFTTHLANTAAEAVLQGRADSILAYHQ
Competitive Binding of a Benzimidazole to the Histone-Binding Pocket of the Pygo Phd Finger. Miller, T.C.R., Rutherford, T.J., Birchall, K. et al. ACS Chem Biol (2014) 9:2864. DOI 10.1021/CB500585S · PubMed
Other PDB entries of the same protein (UniProt Q86UU0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UP5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.