X-ray structure of the human PP1 gamma catalytic subunit treated with ascorbate. Determined by X-ray diffraction at 1.96 Å resolution. Released 22 Jul 2015.
Explore 4UT2 in 3D Show helices and sheets RCSB PDB PDBe
4UT2 contains 30 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-18 | 10 | |
| α-helix | 23 | 1 | |
| α-helix | 32-48 | 17 | |
| β-strand | 52-55 | 4 | 1 |
| β-strand | 59-62 | 4 | 2 |
| β-strand | 64 | 1 | 3 |
| α-helix | 69-79 | 11 | |
| β-strand | 87-89 | 3 | 2 |
| α-helix | 100-113 | 14 | |
| β-strand | 118-120 | 3 | 2 |
| α-helix | 121-123 | 3 | |
| α-helix | 128-131 | 4 | |
| α-helix | 136-143 | 8 | |
| α-helix | 146-156 | 11 | |
| β-strand | 162-165 | 4 | 1 |
| β-strand | 169-171 | 3 | 1 |
| α-helix | 183-187 | 5 | |
| α-helix | 194-196 | 3 | |
| α-helix | 200-206 | 7 | |
| β-strand | 208-209 | 2 | 4 |
| β-strand | 216-218 | 3 | 4 |
| β-strand | 225-227 | 3 | 4 |
| α-helix | 229-239 | 11 | |
| β-strand | 243-246 | 4 | 1 |
| β-strand | 255-258 | 4 | 1 |
| β-strand | 263-266 | 4 | 1 |
| β-strand | 267 | 1 | 3 |
| α-helix | 272-274 | 3 | |
| α-helix | 278-279 | 2 | |
| β-strand | 280-285 | 6 | 2 |
| β-strand | 291-296 | 6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein phosphatase PP1-gamma catalytic subunit | A, B | protein | 323 | HOMO SAPIENS | P36873 (AlphaFold model) |
>4UT2_1 SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUBUNIT (chains A, B) MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE KKKPNATRPVTPPRGMITKQAKK
Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling. Santos, C.X., Hafstad, A.D., Beretta, M. et al. EMBO J (2016) 35:319. DOI 10.15252/EMBJ.201592394 · PubMed
Other PDB entries of the same protein (UniProt P36873 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UT2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.