4V0P: MAGE homology domain of human MAGE-A3

Crystal structure of the MAGE homology domain of human MAGE-A3. Determined by X-ray diffraction at 2.07 Å resolution. Released 1 Oct 2014.

Method: X-ray diffraction
Resolution: 2.07 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,764
Mol. weight: 24.12 kDa
Released: 1 Oct 2014

Explore 4V0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4V0P contains 14 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	103-126	24
β-strand	130-131	2	1
α-helix	132-138	7
α-helix	141-146	6
α-helix	147-162	16
β-strand	164-170	7	1
β-strand	175-180	6	1
α-helix	181-183	3
α-helix	199-212	14
β-strand	216-217	2	2
α-helix	218-225	8
α-helix	229-231	3
α-helix	242-252	11
β-strand	256-260	5	2
α-helix	261	1
β-strand	269-273	5	2
α-helix	275-280	6
α-helix	283-292	10
α-helix	301-303	3
α-helix	304-306	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Melanoma-associated antigen 3	A	protein	213	HOMO SAPIENS	P43357 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4V0P_1 MELANOMA-ASSOCIATED ANTIGEN 3 (chains A)
SMEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLV
FGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAPEEKI
WEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVET
SYVKVLHHMVKISGGPHISYPPLHEWVLREGEE

Primary citation

Structures of Two Melanoma-Associated Antigens Suggest Allosteric Regulation of Effector Binding. Newman, J.A., Cooper, C.D.O., Roos, A.K. et al. PLoS One (2016) 11:48762. DOI 10.1371/JOURNAL.PONE.0148762 · PubMed

Other PDB entries of the same protein (UniProt P43357 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QEW 2.2 Å, Human class I histocompatibility antigen (HLA-a 0201) complex with a nonameric peptide…
9BD2 2.24 Å, MAGE-A3 MHD crystal soaked with KL861
9YTF 2.6 Å, TCR mimic antibody vAB-30 in complex with MAGE-A3 in HLA-A1
5BRZ 2.62 Å, MAGE-A3 reactive TCR in complex with MAGE-A3 in HLA-A1
8T9A 3.17 Å, CryoEM structure of human DDB1-DCAF12 in complex with MAGEA3

Browse structure collections

About this viewer

MolViewer shows 4V0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.